KEGG   Bartonella quintana Toulouse: BQ03390Help
Entry
BQ03390           CDS       T00181                                 

Gene name
ompR
Definition
(GenBank) Transcriptional regulator ompR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bqu  Bartonella quintana Toulouse
Pathway
bqu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bqu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BQ03390 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bqu02022]
    BQ03390 (ompR)
Two-component system [BR:bqu02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BQ03390 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CAF25839
UniProt: A0A0H3LTM5
Position
complement(418851..419555)
Genome map
AA seq 234 aa AA seqDB search
MTDHIQVLSDNAPHLLVIDDDTRIRNLLFQFLLKNGFRVSVSANADEARRQLANLDFDLL
IIDVMMPGENGIDLTHSLRQTKDVPILMLTALSEIDSRINGLEAGADDYLAKPFDPRELL
LRINAILRRGFPLNQPKIEQIVFGPYIFSISRRELKKGGEVIKLTDKEQKMMVIFAENTG
DIIPRHKFATDDSDIGERAIDVQINRLRRKIEKNPATPIWLQTVRGIGYKLSVE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcacattcaagttttaagtgacaatgcaccacaccttcttgtgattgatgac
gacacccgtattcgcaatcttttatttcaatttctccttaaaaatggatttcgtgtttca
gtctctgccaatgccgatgaagcaagacgccagcttgcaaacttagattttgatcttctt
ataattgatgttatgatgcccggcgaaaacggcatcgatcttacccattcactccgtcaa
acaaaagatgttccgattcttatgcttacagctttatcggagatagacagccgtatcaat
ggattagaagcaggtgcagatgattacctcgctaaaccgtttgatccgcgtgaactttta
cttcgtattaatgccattttacgacgtggttttccactcaaccaaccaaaaatcgagcaa
atagtttttggaccttatatattttcaatttcacggcgcgagctcaaaaaaggaggagaa
gttattaaattaaccgataaagaacaaaaaatgatggttatctttgccgaaaatacaggg
gatataattccacgccataaatttgcaacggatgatagcgatataggtgaacgtgccatt
gatgtacaaatcaaccgtctccgtcgtaaaatcgaaaaaaatccagcaacccctatatgg
ctccaaaccgtgcgaggaataggttataaactctcagttgaataa

DBGET integrated database retrieval system