KEGG   Bartonella quintana Toulouse: BQ10560
Entry
BQ10560           CDS       T00181                                 
Name
(GenBank) 17-kDa antigen precursor
Organism
bqu  Bartonella quintana Toulouse
SSDB
Motif
Pfam: T4SS DUF3576 YabA
Other DBs
NCBI-ProteinID: CAF26523
UniProt: A0A0H3M3Q5
Position
1253415..1253861
AA seq 148 aa
MKKYGLVTLLSLSCVSHTIAETALLADEYYKRALENTQKLDAAKSETAESIYASANEITN
KIKEINEKLRKAQAAEKTKPEEFQALQIELSLLQAQLQADTLKIQFLSMIQAKNTKTKED
IREEQTQKKHKDLQEKLKEKLGNSDVRL
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaaaaatatggtttagtcacacttttatctttatcttgcgtctctcatacaatagca
gaaactgcattacttgctgatgaatattacaaaagagcattagaaaacacgcaaaaatta
gatgctgcaaaatcagaaacagcggaatctatttatgcatctgcaaatgaaattactaat
aaaattaaggaaataaacgagaaacttagaaaggctcaggcagctgaaaaaaccaaacct
gaagaatttcaggctcttcaaatagagctgtctcttcttcaagcacagctgcaagcagat
actttaaaaattcaattcctgtctatgattcaagcgaaaaatacgaaaacaaaagaagac
atccgtgaagagcaaacacaaaaaaagcataaagatcttcaagaaaaattaaaagaaaaa
cttgggaattctgatgtccgactttag

DBGET integrated database retrieval system