KEGG   Bartonella quintana Toulouse: BQ12590Help
Entry
BQ12590           CDS       T00181                                 

Gene name
trwJ1
Definition
(GenBank) trwJ1 protein
  KO
K03200  type IV secretion system protein VirB5
Organism
bqu  Bartonella quintana Toulouse
Pathway
bqu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bqu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BQ12590 (trwJ1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bqu02044]
    BQ12590 (trwJ1)
Secretion system [BR:bqu02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BQ12590 (trwJ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4SS THOC7
Motif
Other DBs
NCBI-ProteinID: CAF26718
UniProt: Q6FYI9
Position
1470588..1471340
Genome map
AA seq 250 aa AA seqDB search
MKIKKIIIPLAIAVVLGIPNSAMAFFWGAGAADLSRTVPDIFGSSSQQTSKPSIKNNALL
LALIRQHLEVNKQQLEQAKKMQQSIMGNKASGTSQEKYTSFFFKDPQLVYNSKEKHADIS
ASFEKIRKEEEEVSTSLAGARESIEKRSEYAALVDKAISLQAFQQTENRSKKILELLNEI
DKTKDLKSIADLQAQIKGKLAMIQNEATKLQMVAYLRNTEQELISQQKQKRNLKILNSKS
REMPTIRFIR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaaaaagataataattccattagcgatagccgtagttttagggatcccaaac
tcagcaatggcttttttttggggagctggggcagcggatttaagccgaacagtaccagat
atatttggtagctcctcccaacagacaagtaaaccttcaataaaaaacaatgcgttactt
ttagctttaataagacaacatctcgaggtaaacaagcagcaactggagcaagctaaaaaa
atgcaacagtccataatgggaaataaagcgtccggtacttcacaagaaaaatataccagc
ttttttttcaaagatccacaattggtctataatagtaaggaaaaacatgcagatatatct
gcatcatttgagaagatccggaaagaagaggaagaagtttctacctctcttgctggagcg
cgtgaatctatagaaaaacgtagcgagtatgcagcgttggttgataaagctataagcttg
caagcttttcagcaaacagagaatcgctctaaaaaaattttagagttgttaaacgaaatc
gacaaaacaaaggatctgaaaagcattgctgacttacaggctcagattaagggcaaacta
gccatgatccaaaatgaagcaacaaaattgcaaatggttgcatatttacgcaatacggaa
caggaacttataagccaacaaaaacaaaaacgcaatctaaagattcttaacagtaaaagc
agagaaatgccaactatacgttttatccgatga

DBGET integrated database retrieval system