KEGG   Bartonella quintana Toulouse: BQ12620Help
Entry
BQ12620           CDS       T00181                                 

Gene name
trwJ2
Definition
(GenBank) trwJ2 protein
Organism
bqu  Bartonella quintana Toulouse
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4SS DUF2730 LcrG DUF2780
Motif
Other DBs
NCBI-ProteinID: CAF26721
UniProt: A0A0H3LWR6
Position
1472944..1473735
Genome map
AA seq 263 aa AA seqDB search
MKKLIIIALVSVVLGMPNSILAYSSRGHVNPQTSLYQLQRSLQQSKAREESQKNKEQLKF
DGNALLEALKKQLEINKQQLEEAKRLHESITNNQRTINIQQDSDDFFLKNPQFIYKRDKE
SEINQVAVFIKDIRDKENYLHNVSVSTREARDSINERIKYAALVDKAVSLRVFEETKNRF
SQIEKMLKDIDTMADLKSIANLQAQIKGKLAMIQNEATKLQMVAHLRNAEQELISQLKRK
RSATIFKSENTKMPDIQYVKAIQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctgattattatagcattagtaagtgtagttcttggaatgccaaactcaata
ctagcatactcgagtcgaggtcatgttaaccctcaaacaagtttgtatcagttacaaaga
agcttacaacaaagcaaggctagggaagaatcgcaaaaaaataaagagcagttaaaattt
gatggtaatgctttgctagaagcattaaagaaacagctagagatcaacaaacagcaactc
gaggaagcaaaaagactgcatgagtctataacaaacaatcaaagaaccatcaacatacaa
caagatagtgatgatttttttcttaaaaacccacaattcatctacaaacgcgataaagaa
tcagagataaatcaggttgcagtcttcatcaaagatattagagataaagaaaattatctt
cacaatgtctctgtctctactcgtgaagcacgcgactctatcaatgaacgtatcaaatat
gcagcgttggttgataaagctgtaagtttgcgagtttttgaagaaacaaaaaatcgtttt
agccaaatcgaaaaaatgttaaaagatatcgacacaatggccgatctgaaaagcattgct
aacttacaggctcagattaagggcaaactagccatgatccaaaatgaagcaacaaaattg
caaatggttgcgcatttgcgtaacgctgaacaggaactcatcagccagctaaaacgtaaa
cgcagcgccacaatttttaaaagtgaaaacacaaaaatgccagatatacagtatgtaaag
gccatccagtga

DBGET integrated database retrieval system