KEGG   Bartonella quintana Toulouse: BQ12630Help
Entry
BQ12630           CDS       T00181                                 

Gene name
trwI2
Definition
(GenBank) trwI2 protein
  KO
K03201  type IV secretion system protein VirB6
Organism
bqu  Bartonella quintana Toulouse
Pathway
bqu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bqu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BQ12630 (trwI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bqu02044]
    BQ12630 (trwI2)
Secretion system [BR:bqu02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BQ12630 (trwI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbL Na_K-ATPase
Motif
Other DBs
NCBI-ProteinID: CAF26722
UniProt: Q6FYI5
Position
1473980..1474864
Genome map
AA seq 294 aa AA seqDB search
MAFKMFTQLFTKIDQVIATYVTDISSKIIATMTPFVSISLTIAFIVYGWLIMRGAIDMPV
SGFLSRCLRISIITSIALTTGLYQPDLTNLIIKMPDELVNALISNPPKNSQFTNLIDRVA
EKGFDRASEAFEESAFLNADGLLFGLFGILILLATSFLVAIGGAFILLAKIALILLAGLG
PFFIIALLWQPTYRFFEQWIGQVLSYTILFVLLATMFSLMMDIFANYMGDLKFDGQQNIG
YTLGGALILSITSIMLLLKLSSIASALAKGITFGHLWRHGAGVGNASQKSRIAK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaaaatgtttacgcaactgttcactaaaattgatcaggtaatagcaacatat
gtcacggatatttcatcaaagattattgctacaatgacccccttcgtatccatcagtctt
accatcgccttcatcgtctatggatggctcattatgcgtggggcaatagatatgccagtc
tctggattcttgagccgttgtctgcgaatcagcattattacttcaattgcattaactaca
gggctatatcagccagatctgacaaatttgataataaaaatgcctgatgagctggtaaac
gcgctgataagcaatccaccaaaaaatagtcaattcactaacttgattgacagagtggct
gaaaaaggtttcgaccgtgcaagcgaagctttcgaggaatccgctttcttgaatgccgat
gggttgcttttcggtctcttcggcatcctcatcttgcttgcaacaagcttcctcgtagca
atcggtggtgcattcattctgttagcaaaaatcgcacttatacttctcgccggactcgga
cctttcttcatcattgcattactctggcaaccaacctaccgctttttcgagcaatggata
ggccaagtcttgagctacacaattctctttgtgcttctcgccactatgtttagtctaatg
atggatatttttgcaaattacatgggagatctgaaatttgatggacagcaaaatatcggt
tacacacttggtggtgcactcatcttgtccattacctccattatgctgttgctcaaacta
tccagcattgccagtgctttggcaaaaggcattacctttggacatctctggagacacggt
gcaggggtaggcaatgcttctcaaaaaagtcgcatagccaaatga

DBGET integrated database retrieval system