KEGG   Bartonella quintana Toulouse: BQ12640Help
Entry
BQ12640           CDS       T00181                                 

Gene name
trwH2
Definition
(GenBank) hypothetical protein
Organism
bqu  Bartonella quintana Toulouse
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPAM_1
Motif
Other DBs
NCBI-ProteinID: CAF26723
UniProt: Q6FYI4
Position
1475030..1475173
Genome map
AA seq 47 aa AA seqDB search
MRSIIFTILIASLLSACTLAPKPKQPSNWNRVPVNKVVPAEIQRGVI
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
atgagatcaatcatttttacaattttgattgcgagtcttttatcggcttgcacattggct
ccaaaaccaaaacaacccagtaattggaatcgagtgcctgttaataaagtggtccctgcc
gaaattcagcgaggagtgatatga

DBGET integrated database retrieval system