KEGG   Bartonella quintana Toulouse: BQ12670
Entry
BQ12670           CDS       T00181                                 

Gene name
trwE
Definition
(GenBank) trwE protein
  KO
K03195  type IV secretion system protein VirB10
Organism
bqu  Bartonella quintana Toulouse
Pathway
bqu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bqu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BQ12670 (trwE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bqu02044]
    BQ12670 (trwE)
Secretion system [BR:bqu02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BQ12670 (trwE)
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: CAF26726
UniProt: A0A0H3LV32
Position
1476682..1477854
AA seq 390 aa
MFDNKKGDEINTGAEQDYTEHKHIEGAYGSSELDSERRPIVPGARTLLIVGLIVIVALPI
ALSWKALKMRNAIDVEEEKPQQTVEQIIPRYTPRITEEPKILEEPEKPVQAEELTQSIPP
ALAQLLQTMPPHLIQDAEELARKRMLSSGLNNGSSSESSAENSKKNTFDNGNSGVLFDKL
QPVRLGQSHAAQLRNRDLLITQGTQIDCTLETKIVTSQPGMTTCHLTRDVYSTSGRVVLL
DRGSKVVGFYQSGIQQGQTRVFVQWSRIETPSGVIVNLDSPGTGPLGESGIDGWIDTHFW
QRFGGAIMMSIIGDLGGWVKNKIGQGNKESKEGKEKSLSQNTQGPESVVNEVLHNSINIP
PTLYKNQGERVSIFVARDLDFSDVYSLIIR
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgttcgacaataagaaaggagatgagatcaatacaggtgcagaacaagactacactgag
cataaacatattgaaggtgcgtatggtagctccgaattagactcggaacgccgtccaata
gttcccggtgcacggacattgttaatagtagggctcattgtcatagtagcgttgccgatt
gctctgtcttggaaggctttaaaaatgcgcaatgccatagacgttgaagaagaaaagcct
caacagacagtagagcaaattatacctcgctacacccctcgaatcacagaggaaccgaaa
atcttagaagaaccagaaaaaccagtacaggcagaagaactaacgcagtctattccacca
gccttagcacaacttcttcaaacaatgccaccacatttgatccaggatgctgaagaattg
gcacgcaaacgtatgttaagttctggtcttaacaatggtagcagtagcgaaagctctgca
gaaaattcaaaaaagaatacatttgacaatggaaatagtggtgtattattcgataagctc
cagcctgtacgattaggtcaatcacacgcggcccaactgcgtaaccgtgatctcttgatt
acgcagggaacgcaaatagattgtacgctggaaacaaaaatcgtcacatcacaaccggga
atgacaacatgtcatttaacacgtgatgtctattctacgagcggtcgtgttgttttgctc
gatcgtggttccaaagtcgtcggtttctaccaaagtggcatacaacaaggacaaacgcgc
gttttcgtgcaatggtcgcgtattgaaacgccgtctggtgttattgtcaatcttgactca
cctggtactggccctcttggggaatctgggatcgatggttggattgatacacatttctgg
caaagatttggcggtgcaatcatgatgagtataatcggtgatttgggaggatgggtgaaa
aataaaattggtcaaggaaataaagaaagcaaagaaggcaaggaaaaatcactatctcaa
aatacacagggtcctgaatcagtggttaacgaagttcttcacaattcaatcaacattcca
ccaacactttacaaaaaccaaggcgagcgggtgagtatttttgttgctcgcgatctggat
ttcagcgatgtctacagcctcattatacgctaa

DBGET integrated database retrieval system