KEGG   Bacillus amyloliquefaciens Y2: MUS_0837Help
Entry
MUS_0837          CDS       T02108                                 

Gene name
acoC
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00010  Glycolysis / Gluconeogenesis
bqy00020  Citrate cycle (TCA cycle)
bqy00620  Pyruvate metabolism
bqy01100  Metabolic pathways
bqy01110  Biosynthesis of secondary metabolites
bqy01120  Microbial metabolism in diverse environments
bqy01130  Biosynthesis of antibiotics
bqy01200  Carbon metabolism
Module
bqy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUS_0837 (acoC)
   00020 Citrate cycle (TCA cycle)
    MUS_0837 (acoC)
   00620 Pyruvate metabolism
    MUS_0837 (acoC)
Enzymes [BR:bqy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MUS_0837 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_D23 PYNP_C GCV_H EF_TS
Motif
Other DBs
NCBI-ProteinID: AFJ60886
UniProt: I2C2L2
Position
807061..808260
Genome map
AA seq 399 aa AA seqDB search
MAVKVVMPKLGMAMKKGEVSVWNKKVGDPVEKGESIASINSEKIEMEIEAPESGTLLHIK
VKEGEGVPPGTAICYIGENGEEVREKEAPAPENAGKPQSEPESEQIPAPKAVQKRKHRVK
ISPVARKMAEKAGLKVDTLNGTGPGGRIVKADVIKAMKTEAEPQSSVQTAQPEGKPASAM
RKVIADRMHKSLQNSAQLTLTMKADITELVKWQQQLADSVKKRSGVKLTVTHFVSRAAVL
ALKQHPELNSSYQEERIITYPYVHLGMAVSLENGLVVPVIRDAEKLSFLELADHISTSAR
RAREGNASGDDLRGSTFSITNLGGYGIEHFTPILNPPEAGILGVGASYETPAFKGDELVK
STMLPLSLTFDHRVCDGAPAADFLKTVKALLEEPAGLIL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaaagtagtaatgccgaagctgggaatggcgatgaagaaaggtgaagtatcc
gtctggaataaaaaagtcggcgacccggttgaaaagggagaaagcatcgccagcatcaac
tcggaaaaaatagaaatggaaatagaagcgcctgaaagcggcacgcttcttcatattaaa
gtcaaagagggagaaggagtcccgccgggaacggccatctgttatatcggggaaaacggc
gaagaagtgcgggagaaggaggcgccggctcctgaaaatgcggggaaaccgcaatctgaa
cctgaatctgaacagattcctgctcccaaagccgtgcaaaagcgtaaacaccgcgtgaaa
atatctcctgttgcccgaaaaatggcggagaaagccgggttgaaagttgatacgctgaac
gggacgggacccggaggcagaatcgtaaaagctgacgtcatcaaggccatgaagacggaa
gctgaaccgcagtcttcggttcagacggcacagccggagggaaaaccggcttcagcgatg
agaaaagtgattgcagaccgaatgcacaaaagcctgcaaaacagcgcccagctgacgctg
actatgaaagcggacattacggagcttgtaaaatggcagcagcagctcgccgacagcgtg
aaaaagcggagcggtgttaaactgacggtcacacatttcgtatcccgggccgcggtgctt
gcgctgaaacagcatcctgagctgaacagctcttatcaagaggagcggatcatcacctat
ccatatgtccacctcgggatggcggtttctcttgaaaacggtctcgtcgtgccggtgatc
cgggatgcggaaaagctttcattccttgagcttgcggatcacatcagcacatcggcacgc
cgggcgcgggaaggcaatgcttccggagatgatctgcgcggatcgacattttctattaca
aatctcgggggttacggaattgagcatttcaccccgattcttaatccgcctgaagccggt
attctcggagtgggcgcaagctatgaaacgccggcgtttaaaggagatgagcttgtcaaa
agcaccatgctgccgctgagccttacctttgatcacagagtatgtgacggcgcaccggct
gcggacttcctgaaaacggtcaaagcgctgcttgaagagccggccggattgattttatag

DBGET integrated database retrieval system