KEGG   Bacillus amyloliquefaciens Y2: MUS_1086Help
Entry
MUS_1086          CDS       T02108                                 

Gene name
yhfS
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00071  Fatty acid degradation
bqy00072  Synthesis and degradation of ketone bodies
bqy00280  Valine, leucine and isoleucine degradation
bqy00310  Lysine degradation
bqy00362  Benzoate degradation
bqy00380  Tryptophan metabolism
bqy00620  Pyruvate metabolism
bqy00630  Glyoxylate and dicarboxylate metabolism
bqy00640  Propanoate metabolism
bqy00650  Butanoate metabolism
bqy00900  Terpenoid backbone biosynthesis
bqy01100  Metabolic pathways
bqy01110  Biosynthesis of secondary metabolites
bqy01120  Microbial metabolism in diverse environments
bqy01130  Biosynthesis of antibiotics
bqy01200  Carbon metabolism
bqy01212  Fatty acid metabolism
bqy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MUS_1086 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    MUS_1086 (yhfS)
   00640 Propanoate metabolism
    MUS_1086 (yhfS)
   00650 Butanoate metabolism
    MUS_1086 (yhfS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MUS_1086 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    MUS_1086 (yhfS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MUS_1086 (yhfS)
   00310 Lysine degradation
    MUS_1086 (yhfS)
   00380 Tryptophan metabolism
    MUS_1086 (yhfS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MUS_1086 (yhfS)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MUS_1086 (yhfS)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MUS_1086 (yhfS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bqy04147]
    MUS_1086 (yhfS)
Enzymes [BR:bqy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MUS_1086 (yhfS)
Exosome [BR:bqy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MUS_1086 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFJ61116
UniProt: I2C392
Position
complement(1021341..1022432)
Genome map
AA seq 363 aa AA seqDB search
MEAVITDAKRTIFARENGLLKDCLPEDLAAPLIRHLSRNMPEDIDEVLIGNATGRGGNLA
RLSALAAGLPLSVSGTTIDRQCGSGLDAVRVACHFIKAGAGSMYIAGGAESSSRSPFSSR
ARFSPEHIGDPDMGIAAEYTAQAYGVTRKMQDEYALLSYERSVKANEDGLYRREILPCHG
FAADENMLKKRNMEPLISRAKPVFQSGGSVTAANSCGISDGAAAVCVMEEQKARSLGLKP
RLRFIGSAVSGVHPHYPSAAPVYAVKKLLKERNLSPDDIDIYEINEAFAVKICVFSQQLQ
VPYSKINVRGGALAVGHPYGASGAALVTRLFYEAKRRPDARYAAAAIGSGGGVGLALLFE
VLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtaattacggatgcgaaacggacgattttcgcccgggaaaacggcctgtta
aaagactgtctcccagaagatttggcagctccgctgatccgccatttgagccggaacatg
cccgaagacattgatgaagtcctgatcggaaacgcgacgggccgcggcgggaatctcgcc
cggctgtcagccttggccgccggacttcctttgagcgtgtccggtacgaccatcgacagg
cagtgcggctccggactggacgccgtgagggtcgcgtgccactttatcaaagccggcgcg
gggagcatgtacatcgcgggaggagcggagagcagcagccgttcccctttctcttcccgg
gcgcgcttttctcctgaacacatcggcgatcctgatatgggcatagcagccgagtataca
gcacaggcttacggcgtaacgagaaagatgcaggacgaatatgcccttctcagctatgaa
cggagcgtcaaagcgaacgaagacggcttataccgccgggaaattcttccctgtcacgga
ttcgccgctgacgaaaacatgctgaaaaagcggaacatggagcctctcatctcccgtgcc
aaacccgtctttcagtccggaggctctgtcaccgccgccaacagctgcggaatttctgac
ggggcggcggcagtttgtgtgatggaagaacaaaaagcgcggtctctcggtttaaagcca
agattgcgttttatcggaagcgcggtaagcggcgtccatccgcattatccgtcagcagcc
ccggtttatgccgtcaaaaagcttttgaaggaacggaacctgtcaccggatgatattgat
atatacgaaatcaacgaggcgtttgccgtcaaaatatgcgttttttcacagcagcttcaa
gtgccgtattctaaaataaatgtccggggcggcgctctggccgtcgggcatccgtacggg
gcttccggggcggcgcttgtcacccggcttttttatgaagcaaaaagacgcccggatgcc
cgctacgcagcagcagcgatcggcagcggaggcggagtcggactggcgcttctctttgaa
gtgttaacgtaa

DBGET integrated database retrieval system