KEGG   Bacillus amyloliquefaciens Y2: MUS_1713Help
Entry
MUS_1713          CDS       T02108                                 

Gene name
ylnF
Definition
(GenBank) precorrin-2 dehydrogenase, sirohydrochlorin
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00860  Porphyrin and chlorophyll metabolism
bqy01100  Metabolic pathways
bqy01110  Biosynthesis of secondary metabolites
bqy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MUS_1713 (ylnF)
Enzymes [BR:bqy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     MUS_1713 (ylnF)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     MUS_1713 (ylnF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M TrkA_N TFA2_Winged_2
Motif
Other DBs
NCBI-ProteinID: AFJ61712
UniProt: I2C4Y8
Position
1613361..1613849
Genome map
AA seq 162 aa AA seqDB search
MLPLHINLSGKRIIIAGGGNVALRRLKTVLPEGADITVISPDALPEIKQLADEGRIRWVS
RKIEMKDLAPAFFIIAATNDRSVNQEIAATASETQLVNCVSEAEQGSVYMPKIIRKGRIQ
VSVSTSGASPAHTKRLAEDIEPLITADLAEEVDRLFEKRRRS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctctgcacattaatctaagcggaaaaagaattatcatcgcgggcggaggcaat
gttgccttaagaaggctcaaaacggtgcttccggaaggcgcggatattactgtaatcagt
cccgatgccctgcctgaaattaaacagctggcggatgaaggacgtattcgctgggtttcc
cgtaaaattgaaatgaaggatctcgcgcccgcttttttcatcattgccgcgacaaatgac
cgcagcgtgaatcaggagatagccgcgaccgcttctgaaacacagctggtcaattgtgta
agcgaggctgaacagggcagcgtgtatatgccgaagatcatccgcaaaggtcgcattcaa
gtatccgtatcaacaagcggcgcaagcccggcacatacgaaaagactggctgaggacata
gagcctctcattactgctgatttggctgaagaagtggatcgtttatttgagaaaagaaga
agatcataa

DBGET integrated database retrieval system