KEGG   Bacillus amyloliquefaciens Y2: MUS_1719Help
Entry
MUS_1719          CDS       T02108                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00230  Purine metabolism
bqy01100  Metabolic pathways
Module
bqy_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MUS_1719 (gmk)
Enzymes [BR:bqy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MUS_1719 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 HEM4 AAA_22 RsgA_GTPase MMR_HSR1 AAA_16 AAA ABC_tran RNA_helicase AAA_29
Motif
Other DBs
NCBI-ProteinID: AFJ61718
UniProt: I2C4Z4
Position
1620082..1620696
Genome map
AA seq 204 aa AA seqDB search
MKERGLLIVLSGPSGVGKGTVRQAIFSQQDTKFEYSISVTTRNPREGEVDGVDYFFKSRD
EFERMIENNKLLEWAEYVGNYYGTPVDYVEQTLQEGKDVFLEIEVQGALQVRNAFPEGLF
IFLAPPSLSELKNRIVTRGTETDDLIENRMNAAKAEIEMMDAYDYVVENDDIQTACDKIN
AIVLAEHLKRERVAPRYKKMLEVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaagagggttattaatcgttctctcaggtccctccggagttggaaaaggaacg
gttcggcaagcaatattttcacaacaggacacgaaatttgaatactcaatttcagtcacg
acgagaaacccgagagagggcgaggtcgacggcgtcgattatttctttaaatcaagagat
gaattcgaacgcatgattgaaaacaacaaactgcttgagtgggcggaatatgtcggcaac
tattacggaacgcccgttgattatgtcgaacagacgcttcaagaaggaaaagacgtcttc
ttagagattgaagtgcagggcgcgctccaagtgcgtaatgcatttccggaaggcctgttt
atcttcttagcgccgccgagtctttctgagctgaaaaacagaatcgtgacaagagggact
gaaaccgacgatttaatcgaaaacagaatgaatgccgcaaaagctgaaatcgaaatgatg
gacgcgtatgattatgtcgttgaaaacgacgatatccaaacggcttgtgataagattaac
gcaatcgttctcgccgagcacttaaaacgtgaacgcgtcgctccgagatataagaaaatg
ctggaggtagaataa

DBGET integrated database retrieval system