KEGG   Bacillus amyloliquefaciens Y2: MUS_2173Help
Entry
MUS_2173          CDS       T02108                                 

Gene name
scoB
Definition
(GenBank) 3-oxoacid CoA-transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00072  Synthesis and degradation of ketone bodies
bqy00280  Valine, leucine and isoleucine degradation
bqy00650  Butanoate metabolism
bqy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MUS_2173 (scoB)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MUS_2173 (scoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MUS_2173 (scoB)
Enzymes [BR:bqy01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     MUS_2173 (scoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AFJ62132
UniProt: I2C658
Position
complement(2119631..2120314)
Genome map
AA seq 227 aa AA seqDB search
MIKEADRMRDSRKRMIKRAVKEIKDGMNVNLGIGMPTLVANEIPNDYNVLLQSENGLLGI
GPYPAEGTEDPDLINAGKETITEVKGASYFDSAESFAMIRGGHIDVAILGGMEVSERGDL
ANWMIPGKMIKGMGGAMDLVHGAKRIIVIMEHVNKYGESKVRTECTLPLTGRQVVDRLIT
DLAVFDFLDGRMTLTELQEGVTMEEVFEKTEGHFTVSQSLKNGVRPK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgataaaggaggctgacagaatgagagatagcagaaaacgaatgatcaaacgggctgta
aaggaaataaaggacggaatgaatgtgaacttggggatagggatgccgacgcttgtagcc
aatgagataccgaatgattataacgtcctgcttcagtctgaaaacggcttgctcgggatc
gggccttatccggcggaaggaacggaggaccccgatctgatcaatgcgggaaaagaaacc
attactgaggtaaagggagcctcgtattttgacagtgccgaatcctttgccatgattcgc
ggcggccacattgatgtagcgatcctcggcgggatggaagtttccgaacggggagatttg
gcgaactggatgatccccggcaaaatgatcaaaggaatgggcggcgccatggacttggtc
cacggagcaaaacggattattgtcatcatggagcacgttaataaatatggggaatctaaa
gtgagaacagaatgtacgcttcctttaaccggcaggcaggtggtcgatcggctgatcaca
gatttggctgtattcgattttcttgatggccgtatgacgctcaccgaactgcaggaaggt
gtaacaatggaggaggtctttgagaaaacagaaggtcattttactgtcagccagtcgtta
aaaaacggggtcagaccaaaatga

DBGET integrated database retrieval system