KEGG   Bacillus amyloliquefaciens Y2: MUS_3525Help
Entry
MUS_3525          CDS       T02108                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00260  Glycine, serine and threonine metabolism
bqy00750  Vitamin B6 metabolism
bqy01100  Metabolic pathways
bqy01110  Biosynthesis of secondary metabolites
bqy01120  Microbial metabolism in diverse environments
bqy01230  Biosynthesis of amino acids
Module
bqy_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MUS_3525 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MUS_3525 (thrC)
Enzymes [BR:bqy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MUS_3525 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFJ63396
UniProt: I2C9S2
Position
complement(3337458..3338516)
Genome map
AA seq 352 aa AA seqDB search
MWKGLIHQYKEFLPVTDRTPALTLHEGNTPLIHLPKLSEKLGIELHVKTEGVNPTGSFKD
RGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARAGMKCIVIIPDGKIAFGKLAQAVM
YGAEIIAIDGNFDDALAIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGGAPDIL
AIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGSAAIVRGEVIKNPETVATAIRI
GNPASWDKAVLAAEESAGKIDEVTDEEILHAYQLIAREEGVFAEPGSCASIAGVLKQVKS
GEIPKGSKVVAVLTGNGLKDPNTAVDVSDIKPITLPTDEDSILEYLNGAARV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggacttatccatcaatataaagaatttctgccggtgacggatcggacgccg
gccctgacattacatgaaggcaacacgccgctgattcacctgccgaagctttctgaaaag
ctcggaattgaactgcatgtgaaaacagagggcgttaatccgacggggtcctttaaggac
cgcggcatggtcatggcggtcgccaaagcgaaagaagaaggcaatgataccatcatgtgc
gcctctacaggcaacacatccgccgcggctgcggcatacgcggcgagagccggcatgaaa
tgcatcgtcatcatcccggacggaaaaatcgccttcggaaaacttgcgcaggccgtcatg
tacggtgcggaaatcattgcgattgacggaaactttgacgacgcgctggccatcgtccgg
tcaatttgcgaaaaatcaccgattgcattagtgaattcagtaaacccttaccggattgaa
gggcaaaaaacagcggcctttgaagtatgcgaacagctcggcggagcgccggacattctg
gcgatcccggtaggaaacgccgggaatatcacggcctactggaaagggttcaaagaatac
catgagaaaaacggcaccggacttccgaagatgcgcggttttgaggcggaaggttctgcg
gctatcgtccgcggcgaagtcattaaaaatccagagaccgttgcgacggcaatccgaatc
gggaatcctgccagctgggacaaagcggtgctcgctgcggaagaatcagccggaaaaatt
gatgaagtcacagatgaagaaattcttcacgcttatcagctgattgcccgtgaagaaggc
gtgtttgccgaaccgggctcctgtgcatccatcgccggcgttttgaaacaggtgaaatcc
ggtgaaattccaaaaggcagcaaggttgtcgcagttttgaccggaaacggcctgaaagat
ccgaacacggctgtggacgtttctgacataaaaccgattacgctgccgacagatgaggac
agtattctggaatacttaaatggagcggcgcgtgtatga

DBGET integrated database retrieval system