KEGG   Bradyrhizobium sp. ORS 278: BRADO0001Help
Entry
BRADO0001         CDS       T00516                                 

Gene name
dnaA
Definition
(GenBank) Chromosomal replication initiator protein dnaA
  KO
K02313  chromosomal replication initiator protein
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bra00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BRADO0001 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bra03032]
    BRADO0001 (dnaA)
   03036 Chromosome and associated proteins [BR:bra03036]
    BRADO0001 (dnaA)
DNA replication proteins [BR:bra03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BRADO0001 (dnaA)
Chromosome and associated proteins [BR:bra03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    BRADO0001 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA AFG1_ATPase
Motif
Other DBs
NCBI-ProteinID: CAL73974
RhizoBase: BRADO0001
UniProt: A4YJ98
Position
936..2366
Genome map
AA seq 476 aa AA seqDB search
MTNSEQERWSRVKGRLRSTVGEDVYTSWFARMDLEAVQDESVHLSVPTRFLKSWIQAHYA
ERVLSAWQAEMPEVHRIDLSVRTAMRCATPAKEAPAAVEARRPERSDAKPVSDARAPVMT
PVAASHDALGGSPLDPRLTFASFVVGRANTLAHAAARQVADGRRGDPVMFNPLYIHAGVG
LGKTHLLQAVTWAGNAGGERKVLYLTAEKFMYGFVAALKSQTALAFKEALRGIDVLVIDD
LQFLQGKSTQAEFCHTLNALIDAGRQVVIAADRPPSDLESLDDRVRSRLAGGLVVEMATL
GEDLRLGILKSRVAAARAHHASFDVPEAVLDYLARSITHNGRDLEGAINRLLAHSKLNNQ
PVTLDMAEREVRDLVRPQEPKRIKIEDIQRVVARQYNVSRSDLLSSRRTANVVRPRQVAM
YLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKIEALVGKDVALNDEVESLKRQLQD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattcggaacaggaacgctggtctcgcgtgaagggtcggctgcgctcgaccgtt
ggcgaggacgtctatacgagctggtttgcccgcatggacctcgaagccgtccaggacgaa
agcgtccatctgtcggtgccgacgcgctttctgaagagctggatccaggcgcattatgcc
gagcgcgtgctgtccgcctggcaggccgaaatgcccgaggtgcatcgcatcgacctctcc
gtgcgcaccgcgatgcgctgcgcgacgcccgccaaggaagcgcccgccgcggtggaggcg
cgccgccccgagcgtagcgacgccaagccggtatccgacgcccgcgcaccggtcatgact
ccggtagccgccagccatgatgcgctgggcggctcgccgctcgacccgcgcctgaccttc
gcgagcttcgtggtcggccgcgccaacacgctcgcccatgcggccgcgcgccaggtggcc
gacggccgacgcggcgatccggtgatgttcaatccgctttacattcacgccggcgtcggt
ctcggcaagacgcatctgctgcaggccgtgacctgggccggcaatgccggcggcgagcgc
aaggtgctgtatctcaccgccgagaagttcatgtatggcttcgtcgcggcgttgaaatcg
cagaccgcgctggccttcaaggaggcactgcgcggcatcgacgtgctcgtgatcgacgac
ctgcagttcctgcagggcaagtcgacccaggcggagttctgtcacaccttgaacgcgctc
atcgacgccgggcgccaggtggtgatcgccgccgaccggccgccgtccgatctcgagagc
ctcgacgaccgcgtccgctcgcggctcgccggcggtctcgtcgtcgagatggcgacgctc
ggcgaggaccttcgcctcggcattctcaagtcgcgcgtcgcggcggcccgcgcgcatcat
gcgagcttcgacgtgccggaggcggtgctggattatctcgcccgctccatcacccataac
ggccgcgacctcgaaggcgcgatcaaccgcctgctggcgcattccaagctcaacaaccag
ccggtcacgctcgacatggccgagcgcgaggtacgcgatctggtccgcccgcaggagccg
aagcggatcaagatcgaggacatccagcgcgtcgtggcgcggcaatacaatgtcagccgc
tccgacctcctgtcctcgcgccgcaccgccaatgtcgtgcgcccgcgccaggttgcgatg
tacctcgccaagacgctgaccttgcgctccctgcccgagatcggccgccgcttcggcggg
cgcgaccacaccacggtgctgcacgccgtgcgcaagatcgaggccctggtcggcaaggac
gtcgcgctgaacgacgaggtcgagtcgctcaagcgccagctgcaggactag

DBGET integrated database retrieval system