KEGG   Bradyrhizobium sp. ORS 278: BRADO0399
Entry
BRADO0399         CDS       T00516                                 

Definition
(GenBank) putative ABC transporter, ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
bra  Bradyrhizobium sp. ORS 278
Brite
KEGG Orthology (KO) [BR:bra00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bra02000]
    BRADO0399
Transporters [BR:bra02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    BRADO0399
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_16 MeaB RsgA_GTPase AAA_33 AAA_30 AAA_25 cobW AAA_5
Other DBs
NCBI-ProteinID: CAL74347
RhizoBase: BRADO0399
UniProt: A4YKC1
Position
complement(405939..406646)
AA seq 235 aa
MAGTAPDTITISNVNLSLGTGAARVHILKDISLRVGQGETIGLIGPSGSGKSTLLMVMAG
LERPDSGEVVVNGTAFNALDEDALARFRGRQVGIVFQSFHLIPTMTALENVAVPLELAGH
SGAAERAARELDSVGLGHRLQHYPTQLSGGEQQRVALARALAPDPAILVADEPTGNLDEA
TGRQIVDLLFTKHAERGMTLVLVTHDSGLAHRCDRVVRLRSGRIEADGAHEPADA
NT seq 708 nt   +upstreamnt  +downstreamnt
ttggccggcacagcaccggacaccattaccatctcgaacgtcaacctctcgctcggcacc
ggcgcggcgcgggttcatatcctcaaggacatcagcctgcgggtgggacagggcgagacg
atcggcctgatcggcccctcgggatcggggaagtccacgctgctgatggtgatggcgggg
ttggaacgtccggacagcggtgaggtggtggtcaacggcaccgctttcaatgccctggac
gaggacgccctggcccggttccgcggccgccaggtcggcatcgtcttccagtcctttcat
ttgatcccgaccatgaccgcgctggagaacgtcgcggtgccgctggagctggccggtcat
tccggtgccgccgagcgggccgcccgcgagctggattcggtcgggctcggccaccggctg
cagcactacccgacgcaactgtcgggcggtgagcagcagcgcgtggctttggcccgggcg
ctggcgccggatccggccatcctcgtggccgacgagccgaccggcaatctcgacgaagcg
acgggacgacagattgtcgacctccttttcaccaagcatgccgagcgcggcatgaccctg
gtgctggtaactcatgacagcggtctcgcccaccgctgcgaccgcgtggtacgactgcgc
tccggccggatcgaagccgacggcgcccacgagcccgccgacgcatga

DBGET integrated database retrieval system