KEGG   Bradyrhizobium sp. ORS 278: BRADO0983Help
Entry
BRADO0983         CDS       T00516                                 

Gene name
pimB
Definition
(GenBank) Acetyl-CoA acetyltransferase with thiolase domain (Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00071  Fatty acid degradation
bra00072  Synthesis and degradation of ketone bodies
bra00280  Valine, leucine and isoleucine degradation
bra00310  Lysine degradation
bra00362  Benzoate degradation
bra00380  Tryptophan metabolism
bra00620  Pyruvate metabolism
bra00630  Glyoxylate and dicarboxylate metabolism
bra00640  Propanoate metabolism
bra00650  Butanoate metabolism
bra00900  Terpenoid backbone biosynthesis
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01120  Microbial metabolism in diverse environments
bra01130  Biosynthesis of antibiotics
bra01200  Carbon metabolism
bra01212  Fatty acid metabolism
bra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRADO0983 (pimB)
   00630 Glyoxylate and dicarboxylate metabolism
    BRADO0983 (pimB)
   00640 Propanoate metabolism
    BRADO0983 (pimB)
   00650 Butanoate metabolism
    BRADO0983 (pimB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BRADO0983 (pimB)
   00072 Synthesis and degradation of ketone bodies
    BRADO0983 (pimB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRADO0983 (pimB)
   00310 Lysine degradation
    BRADO0983 (pimB)
   00380 Tryptophan metabolism
    BRADO0983 (pimB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BRADO0983 (pimB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRADO0983 (pimB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BRADO0983 (pimB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bra04147]
    BRADO0983 (pimB)
Enzymes [BR:bra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BRADO0983 (pimB)
Exosome [BR:bra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRADO0983 (pimB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAL74898
RhizoBase: BRADO0983
UniProt: A4YLX2
Position
1043904..1045091
Genome map
AA seq 395 aa AA seqDB search
MTDAVIVSTARTPIGKAYRGALNATGGATLLGHAIGEAVKRAKIDPAEVEDVVMGAALQQ
GSTGGNIARKALLRAGLPVSVGGTTIDRQCASGLQAIALAARSVIFDGVEIAVGGGGESI
SLVQNDKMNSFQATDAALLEIKGDVYMPMIDTAEVVAKRYGISREKQDEYALESQRRTAA
AQQGGKFNEELAPISTKMAVTDKATGNISFKDITLSQDEGPRPETTAEGLAGLKAVRGDG
FTITAGNASQLSDGASASVIMSDKEAAKRGLQPLGIFRGFVAHGCEPDEMGIGPVFAVPR
LLKRHGLTVDDIGLWELNEAFAVQVLYCRDKLGIDPDKINVNGGAISVGHPYGMSGARLT
GHALIEGRRRKAKYAVVTMCVGGGMGAAGLFEVLQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgccgtcatcgtttccaccgcccgcacgccgatcggcaaggcctatcgcggc
gcgctcaacgccaccggcggcgcgacgctgctcggccacgccatcggcgaagccgtcaag
cgcgccaagatcgatccggccgaggtcgaggacgtcgtgatgggcgcggccctgcagcag
ggctcgaccggcggcaacatcgcacgcaaggcgctgttgcgcgccggcctgccggtgtcg
gtcggcggcaccaccatcgaccggcaatgcgcttcgggtctgcaggcgatcgcgctcgcg
gcgcgctcggtgatcttcgacggcgtcgagatcgcggtcggcggcggcggcgagtcgatc
tcgctggtccagaacgacaagatgaacagctttcaggccaccgatgcggcgctgcttgag
atcaagggcgacgtctacatgccgatgatcgacaccgccgaggtggtcgccaagcgctac
ggcatctcgcgcgagaagcaggacgaatatgcgctggagagccagcgccgcaccgcggcc
gcgcagcagggcggcaagttcaacgaggaactggcgccgatctcgaccaagatggcggtg
acagacaaggcgaccggcaacatctcgttcaaggacatcacgctgtcgcaagatgagggc
ccgcgcccggagaccaccgccgaaggtctcgccggcctcaaggccgtgcgcggcgacggc
ttcaccatcaccgccggcaatgccagccagctgtcggacggcgcctcggcctcggtgatc
atgagcgacaaggaagccgccaagcgcggcctgcagccgctcggcatcttccgcggcttc
gtcgcgcatggctgcgagccggacgagatgggcatcggcccggtgttcgcggtgccgcgc
ctgctgaagcgccacggcctcaccgtcgacgacatcggcctgtgggagctcaacgaggcc
ttcgcagtgcaagtgttgtattgccgcgacaagctcggcatcgaccccgacaagatcaac
gtcaatggcggcgccatctcggtcggccatccctacggcatgtcgggcgcgcgcctcacc
ggccacgccctgatcgagggccgccgccgcaaggccaaatacgccgtcgtcaccatgtgc
gtcggcggcggcatgggcgccgccggcctattcgaggtgctgcaataa

DBGET integrated database retrieval system