KEGG   Bradyrhizobium sp. ORS 278: BRADO1043Help
Entry
BRADO1043         CDS       T00516                                 

Gene name
ureE
Definition
(GenBank) Urease accessory protein UreE
  KO
K03187  urease accessory protein
Organism
bra  Bradyrhizobium sp. ORS 278
Brite
KEGG Orthology (KO) [BR:bra00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    BRADO1043 (ureE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UreE_C UreE_N
Motif
Other DBs
NCBI-ProteinID: CAL74957
RhizoBase: BRADO1043
UniProt: A4YM31
Position
1110280..1110912
Genome map
AA seq 210 aa AA seqDB search
MIRATRVLGQHRWKEAAADSVLLDFDDRHRRRLAMTGTRGLEFLLDLEHATALRGGDALV
LEDGRLIEVVAAAEPLLEIRAGDPHHLVRLAWHLGNRHLPTQIMAKSLRIRRDHVIEAMV
KGLGARVIEIEAPFDPEGGAYAEPSHAHGDHDHDHHGHDHHGHDHTSHDHAHHSHAHHDH
DHGHAHDDHVHDEHCGHDHHHGHSHAHDHK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgccacgcgcgtgctcgggcagcatcgttggaaagaggccgctgccgattcc
gtcctgctcgatttcgatgatcggcaccggcgaaggttggcgatgaccggcacgcgcggg
ctggaattcctgctcgatctcgagcacgcgaccgcgcttcggggcggcgatgcgctcgtg
ctggaggatggccggctgatcgaggtggtcgccgctgctgagccgctgctcgagatccgc
gccggcgatccgcatcatttggtgcggctcgcctggcatctcggcaaccggcatctgccg
acccagatcatggccaagagcctgcgcatccgccgcgaccacgtcatcgaggcgatggtg
aagggtcttggcgcgcgcgtcatcgagatcgaggcgccgttcgatccggaaggcggcgcc
tacgccgagcccagccatgcgcatggcgatcacgatcacgatcatcatggccatgatcac
cacggccacgatcacaccagtcatgatcacgcgcatcacagccacgcgcatcatgatcat
gaccacggccatgcgcacgacgatcacgtgcatgacgagcattgcggccacgaccaccat
cacggtcattcccatgctcatgaccacaaatga

DBGET integrated database retrieval system