KEGG   Bradyrhizobium sp. ORS 278: BRADO1616Help
Entry
BRADO1616         CDS       T00516                                 

Gene name
crtF
Definition
(GenBank) demethylspheroidene and didehydrorhodopin O-methyltransferase
  KO
K09846  demethylspheroidene O-methyltransferase [EC:2.1.1.210]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00906  Carotenoid biosynthesis
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    BRADO1616 (crtF)
Enzymes [BR:bra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.210  demethylspheroidene O-methyltransferase
     BRADO1616 (crtF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_12 Methyltransf_23 Methyltransf_25 Methyltransf_11 MTS CMAS
Motif
Other DBs
NCBI-ProteinID: CAL75495
RhizoBase: BRADO1616
UniProt: Q7BP85
Position
1730820..1731965
Genome map
AA seq 381 aa AA seqDB search
MPAALRHDTPAPVSFGDRWRGWRDALLASASFQRWAAAFPLTRPIARKRAAELFDLCAGF
VYSQTLAACVQLDLFEGLRAGPRDLPVLASRAAMPESAMESLCEAACALQLLERRGTARY
GLGPLGAALLGNPGIAAMVRHHAALYADLGDPLALLRGHERERRLAQYWPYALDHTGATL
TRDDVAPYTALMAATQPMIADVVLSAYPLTGHRCLLDVGGGDGSFLAAAARAAPQLRLQL
FDLPEVAAIARERLGTAGLADRATITPGSFYDDPLPTGADVISLIRVVHDHDDEAVARLL
AKVRAALPADGVLLLGEPMSDAAAGSDGVSAYFEIYLRAMGQGRPRSAARLRELLHMAGF
SQVRALRTRIPLIAGVIVAES
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgcccttcgccacgacacgccggcgccggtcagcttcggtgatcgctggcgc
ggctggcgcgacgcgctgctggccagtgcttcgttccagcgctgggcggcagcctttccg
ctgacgcggccgatcgcgcgcaagcgggcggcggagctgttcgatctctgcgccggcttc
gtctattcgcagaccttggcggcttgcgtgcagctcgatctgttcgagggtttgcgtgcc
gggccgcgcgacctcccggtgctcgcctctcgcgccgcgatgcccgagtcggcgatggaa
agcctgtgcgaagcggcctgcgcgctgcaactgctcgagcgccgcggcacggcgcgttat
ggccttggaccgctgggcgccgcgctgctcggcaatcccggcattgccgccatggtccgg
catcacgccgcgttgtacgccgatctgggcgatcccttggcgctcctgcgcgggcacgag
cgcgaacgccgtctcgctcaatattggccctatgcgctcgatcacacaggggcgacgctg
acgcgcgacgatgtcgcgccctataccgcgctgatggcggccacgcagccgatgatcgcc
gacgtggtgctgtccgcctatccgctcacgggccatcgctgcctgctcgacgtcggcggc
ggtgacggttccttcctcgctgccgccgcgcgagcggcgccgcagctgcggctgcagctg
ttcgatctgccggaggtcgccgcgatcgcccgggagcgtctggggacagccggcttggcc
gaccgtgcgacgatcacgccgggcagcttctacgacgacccgctgcctacgggcgccgat
gtgatctcgctgattcgcgtcgtgcacgatcacgacgacgaggcggtggcgcgcctgctg
gccaaagtgcgcgcggcgctgcccgccgatggcgtgctgttgctcggcgagccgatgagc
gatgctgcggccggcagcgatggggtaagcgcctatttcgagatctatctccgtgcgatg
gggcagggacggccgcgcagcgcggctcgcctgcgcgagcttctccacatggcagggttt
tcgcaggtgcgagcgcttcgcacccgcatcccattgatcgccggtgtgattgtcgcggaa
agctga

DBGET integrated database retrieval system