KEGG   Bradyrhizobium sp. ORS 278: BRADO1630Help
Entry
BRADO1630         CDS       T00516                                 

Gene name
cycA
Definition
(GenBank) cytochrome c2
  KO
K08738  cytochrome c
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bra00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BRADO1630 (cycA)
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    BRADO1630 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: CAL75509
RhizoBase: BRADO1630
UniProt: Q8VUB4
Position
1746273..1746707
Genome map
AA seq 144 aa AA seqDB search
MLKSGLVAAVVIATSAGAAFALDGGDAAKGEQVFKQCMTCHRIGPDAKNAVGPVLTGVVG
RPTGTAPGFAYSELNKHAGEAGLVWTDDNIFEYLADPNAFLKKYLTEKGKADQATGSTKM
VFKLANEQQRKDVVAYLKTFSEKK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaatcgggtttggttgcggcggtcgtgattgcaacgtcggcaggcgccgcattc
gcgctggacggcggcgacgctgcgaaaggcgagcaggtcttcaagcaatgcatgacctgc
caccgcatcggacccgatgcgaagaatgctgtgggtccggttctgaccggtgtggtcggc
cgcccgacggggaccgctccgggatttgcctattccgagctcaacaagcacgccggcgag
gccgggctggtctggaccgatgacaacatcttcgaatacctcgccgaccccaacgccttc
ctgaagaaatatctcaccgagaagggcaaggcggaccaagccaccggctcgaccaagatg
gtgttcaagctcgccaacgagcagcagcgcaaggacgtcgtcgcttatcttaagaccttc
tcggagaagaagtga

DBGET integrated database retrieval system