KEGG   Bradyrhizobium sp. ORS 278: BRADO2393Help
Entry
BRADO2393         CDS       T00516                                 

Definition
(GenBank) putative acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00071  Fatty acid degradation
bra00072  Synthesis and degradation of ketone bodies
bra00280  Valine, leucine and isoleucine degradation
bra00310  Lysine degradation
bra00362  Benzoate degradation
bra00380  Tryptophan metabolism
bra00620  Pyruvate metabolism
bra00630  Glyoxylate and dicarboxylate metabolism
bra00640  Propanoate metabolism
bra00650  Butanoate metabolism
bra00900  Terpenoid backbone biosynthesis
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01120  Microbial metabolism in diverse environments
bra01130  Biosynthesis of antibiotics
bra01200  Carbon metabolism
bra01212  Fatty acid metabolism
bra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRADO2393
   00630 Glyoxylate and dicarboxylate metabolism
    BRADO2393
   00640 Propanoate metabolism
    BRADO2393
   00650 Butanoate metabolism
    BRADO2393
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BRADO2393
   00072 Synthesis and degradation of ketone bodies
    BRADO2393
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRADO2393
   00310 Lysine degradation
    BRADO2393
   00380 Tryptophan metabolism
    BRADO2393
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BRADO2393
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRADO2393
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BRADO2393
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bra04147]
    BRADO2393
Enzymes [BR:bra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BRADO2393
Exosome [BR:bra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRADO2393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAL76219
RhizoBase: BRADO2393
UniProt: A4YQP3
Position
2550313..2551545
Genome map
AA seq 410 aa AA seqDB search
MVDALIIDACRTPRGIGKAGKGALAGLHPQHLGATVLRALAERTGIDTGDVDDIIWGCSS
QRGPQSGDLGRMSALDAGYDIRASGVTLDRFCGSGITSVNIAAAQIMAGQEDLVVAGGCE
MMSMEGRRGEGPLMMDAGNLHLRALHPQSHQGVCADAIATMEGITRSDVDALGLESQKRA
AAAIAGGHFKKSLVPVHREDGSLALDHEEYPRPQTTAEALAGLKPAFPAIADYALDDKGT
TYRNLILQRYPGLDIQFVHHAGNSSGVVDGAAAILLASPSYAKAHGLKPRARVVAMANMG
DDPTLMLNAPVPATRKVLAKAGLTIDDIDLFEINEAFAVVAEKYIRDLKLDRAKVNVNGG
SIALGHPIGATGSILIGTLLDELERRDLKRGLVTMCAAGGMAPAIIIERV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgcactcatcatcgatgcctgcaggaccccgcgaggtatcggcaaggccggc
aagggggcgctggccggtctgcatccgcagcatctcggcgccaccgtgctgcgtgcgctg
gccgagcgcaccggcatcgacaccggcgatgtcgacgacatcatctggggctgctcgtcg
cagcgcggaccgcagagcggcgatctcggccgcatgtcggcgctcgatgccggctatgac
atccgcgcctccggcgtcacgctcgaccgcttctgcggctccggcatcaccagcgtcaac
attgcggctgcccagatcatggccgggcaggaggatctcgtcgtcgccggcggctgcgag
atgatgtccatggaaggtcggcgcggcgaggggccgctgatgatggatgccggcaatctg
catctccgcgcgctgcacccgcagtcgcaccagggcgtttgcgcggacgccatcgccacc
atggaaggcatcacgcggtccgatgtcgatgcgctcgggctggagagccagaagcgggcg
gcggcggcgatcgcgggcgggcacttcaagaagagcctggtgccggtgcatcgcgaggac
ggcagcctcgcgctcgatcacgaggagtatccccggccgcagaccacggccgaggcgctc
gccggcttgaagccggcgttccccgcgatcgccgactatgcgctggacgacaagggcacg
acctaccgcaacctgatcctgcagcgctacccgggtctcgatattcagttcgtgcaccac
gccggcaactcctccggcgtcgtcgacggcgccgcggcgatcctgctggcctcgccgtcc
tacgccaaggcgcacggcctgaagccgcgggcgcgagtggtggcgatggccaatatgggc
gacgacccgacgctgatgcttaacgccccggtgccggcgacccgtaaggtgctcgccaag
gccgggctgaccatcgacgacatcgacctgttcgagatcaacgaggccttcgccgtcgtg
gccgagaagtacatccgcgacctcaagctcgaccgcgccaaggtcaacgtcaacggcggc
tcgattgcgctcgggcatccgatcggcgccaccggttccatcctgatcggaacgctgctc
gacgagctggagcggcgcgacctcaagcgcggcttggtgacgatgtgtgccgccggcggc
atggctccggcgatcatcatcgagcgcgtctga

DBGET integrated database retrieval system