KEGG   Bradyrhizobium sp. ORS 278: BRADO2457Help
Entry
BRADO2457         CDS       T00516                                 

Definition
(GenBank) putative NAD-dependent alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00010  Glycolysis / Gluconeogenesis
bra00071  Fatty acid degradation
bra00350  Tyrosine metabolism
bra00625  Chloroalkane and chloroalkene degradation
bra00626  Naphthalene degradation
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01120  Microbial metabolism in diverse environments
bra01130  Biosynthesis of antibiotics
bra01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO2457
  Lipid metabolism
   00071 Fatty acid degradation
    BRADO2457
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRADO2457
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BRADO2457
   00626 Naphthalene degradation
    BRADO2457
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BRADO2457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N ThiF Glu_dehyd_C Urocanase HemY_N
Motif
Other DBs
NCBI-ProteinID: CAL76280
RhizoBase: BRADO2457
UniProt: A4YQV4
Position
2617472..2618563
Genome map
AA seq 363 aa AA seqDB search
MPDHGSESMKSFKVTDFNAPLTEVDEPTPQPFGKQVLIKVKAAGVCHSDLHIWEGGYDLG
HGRKPLSLKDRGVSLPRTMGHESAGEIVAFGPEVTEAEKGGLKVGDVALVYPWIGCGKCA
TCLAGDENMCLKPASLGVYCDGGYADHMTVPHPRHLIDLKGLDPVTTAPYACSGVTTYSA
LKKVETDFDTPIVIFGAGGLGLMALSLLKAMGGKGAIVVDIDARKREAALAAGALAAVDG
KAPDALEQLNKAAGEPIRAVIDLVGNAATAQLGFDCLTKGGKLVIVGLFGGGAPWALPLI
PIKAVTIQGSYVGNLRETKELLDLVRAKNIAPIPVTPMPLARANDALHELQKGQLVGRAV
LTP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgccggaccacgggagtgaaagcatgaagagcttcaaggtcaccgatttcaacgcgccg
ctgaccgaggtcgacgagccgacgccgcagccgtttggcaagcaggtgctgatcaaggtg
aaggcggccggcgtctgccatagcgacctgcacatctgggaaggtggctatgaccttggc
cacggccgcaagccgctgtccttgaaggatcgcggcgtctcgctgccgcggaccatggga
cacgagagcgccggtgagatcgtggcgttcgggcccgaggtcaccgaagccgagaaaggg
ggcttgaaggttggcgacgtcgcgctggtctatccctggatcggctgcggcaaatgtgcc
acttgcctcgccggcgacgagaacatgtgtctgaaaccggcctcgctcggcgtctattgc
gacggcggttatgccgatcacatgacggtgccgcatccgcgccacctgatcgatctcaag
ggtctcgatcccgtgacgaccgcgccttatgcctgctcgggcgtgacgacctacagcgcg
cttaaaaaggtcgagacggattttgatacgccgatcgtcatcttcggcgccggcggtctc
ggcctgatggcgctgtccttgctcaaggcgatgggcggcaagggcgccatcgtcgtcgac
atcgacgcccgcaagcgcgaggccgcgctcgcggcaggcgcgctggccgccgtcgacggc
aaggcgccggatgcgctggagcagttgaacaaggcggcgggcgagccgatccgggcggtg
atcgacctggtcggcaatgccgccacggcgcagctcggcttcgactgcctgaccaagggc
ggcaagctcgtcatcgtcggcctgttcggcggcggcgcgccctgggcgctgccgctcatt
ccgatcaaggcggtgacgatccagggcagctatgtcggcaatctgcgcgagaccaaggaa
ctgctcgacctcgtccgcgccaagaacatcgcgccgatcccggtgaccccgatgccgctc
gcgagggccaatgatgccctgcacgagctgcaaaagggccagctggtcggccgcgcggtg
ctgacgccgtag

DBGET integrated database retrieval system