KEGG   Bradyrhizobium sp. ORS 278: BRADO2765
Entry
BRADO2765         CDS       T00516                                 

Definition
(GenBank) Putative HlyD family secretion protein
  KO
K11003  hemolysin D
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bra00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    BRADO2765
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 HlyD Biotin_lipoyl_2 PTS_EIIA_1 YgbB Biotin_lipoyl Tricorn_PDZ CSD2 DivIC
Other DBs
NCBI-ProteinID: CAL76576
RhizoBase: BRADO2765
UniProt: A4YRQ0
Position
2974513..2975931
AA seq 472 aa
MSTSANHLRGFSFGGNTSEREFLPAALEITETPPNPLGRITALALCTVTFAALGWAVFGK
VDIVAVASGKVISHTRTQVVQPFETASVKAVLVQPGQRVRAGDALIELDRTAVTAEADRA
RSDLIASLLDEVRLAAFLDGVKNGPFDLVAGAEPLDRARAQAQLTAQLAMRASQLAALAQ
ERAQHVAEREALQQTVAKYEQTLPMVTQRADIRTKASEIGNASIIALLESQQLLVETRSE
LEINKAKIVALDATIAGLDQKIAATEAEIRDKAMRDLATARERARAAGEALTKAARRAEL
QTLRAPIDGTVQQMHIAAAGAVVTPAQQLLSVVPDDDRIEVEAVVENRDVGFVEAGQRVE
LKVDAFPFTRYGLLGGKVTSVDRDAEAAPVNPQGVQGAERQADQTDRVEASERLRYMVHI
ALDRATLDVDGRAAALVPGMSVKAEILTGKRRIIDFLLAPLSEHVHDAMRER
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgagcacatctgcaaatcacttgcgtggcttctcgttcggcggcaacacgtcggagcgc
gagttcctgccggcggcgttggagatcacggagacgccgcccaacccgctcggacgcatc
accgcgctggcactatgcacggtgacatttgcggcgctcggctgggcggtgttcggcaag
gtcgacatcgtcgcggtcgccagcggcaaggtgatttcgcatacccgcacccaggtggtg
cagccgttcgagacggcgagcgtcaaggccgtgctggtacagcccggtcagcgcgtgcgc
gccggcgacgcgctgatcgagctcgacaggaccgccgtgacggcggaggccgaccgggcc
cgcagcgatctgatcgcgagcctgctcgacgaagtccggctggcggccttcctggatggc
gtgaagaacggaccgttcgatctggtggccggcgccgagccgctcgatcgcgcccgtgcc
caggcgcagctcacggcgcagctggcgatgcgcgccagccagctggcggcgctggcgcag
gagcgcgcccaacatgttgccgagcgcgaggcgctgcaacagacggtcgcgaaatacgag
cagaccctgccgatggtgacgcagcgcgccgatatccgcaccaaggcgagcgagatcggc
aacgcctcgatcatcgcgctgcttgagagccagcagctgctggtcgagacccgctcggag
ctcgagatcaacaaggcgaaaatcgttgcgctcgatgccaccatcgccgggctcgatcag
aagatcgcggcgacggaggccgagatccgcgacaaggcgatgcgcgatctcgccaccgcg
cgcgagcgcgcccgcgccgccggcgaagcgctgaccaaggcggcgcggcgcgccgagctg
cagaccttgcgcgcgccgatcgacggcacggtgcagcagatgcacatcgcggccgccggc
gccgtggtaacgccggcgcagcagctgctgtccgtcgtgcccgatgacgacaggatcgag
gtcgaggccgtggtcgagaaccgcgacgtcggcttcgtcgaggccggccagcgcgtcgag
ctcaaggtcgatgccttcccgttcacgcgctacggcctgctgggcggcaaggtgacctcg
gttgaccgcgacgcggaggccgcgccggtcaatccccagggcgtgcagggcgccgagcgg
caggcggaccagaccgaccgcgtcgaggccagcgagcggctgcgctacatggtgcacatc
gcgctcgaccgcgcgacgctggacgtcgacggccgtgccgcggcgctggtgccgggcatg
tcggtgaaggccgagatcctgaccggcaagcgccgcatcatcgacttcctgctagcgccg
ctcagcgagcacgtccacgacgccatgcgcgagcgctga

DBGET integrated database retrieval system