KEGG   Bradyrhizobium sp. ORS 278: BRADO3110Help
Entry
BRADO3110         CDS       T00516                                 

Definition
(GenBank) putative 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00071  Fatty acid degradation
bra00072  Synthesis and degradation of ketone bodies
bra00280  Valine, leucine and isoleucine degradation
bra00310  Lysine degradation
bra00362  Benzoate degradation
bra00380  Tryptophan metabolism
bra00620  Pyruvate metabolism
bra00630  Glyoxylate and dicarboxylate metabolism
bra00640  Propanoate metabolism
bra00650  Butanoate metabolism
bra00900  Terpenoid backbone biosynthesis
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01120  Microbial metabolism in diverse environments
bra01130  Biosynthesis of antibiotics
bra01200  Carbon metabolism
bra01212  Fatty acid metabolism
bra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRADO3110
   00630 Glyoxylate and dicarboxylate metabolism
    BRADO3110
   00640 Propanoate metabolism
    BRADO3110
   00650 Butanoate metabolism
    BRADO3110
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BRADO3110
   00072 Synthesis and degradation of ketone bodies
    BRADO3110
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRADO3110
   00310 Lysine degradation
    BRADO3110
   00380 Tryptophan metabolism
    BRADO3110
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BRADO3110
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRADO3110
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BRADO3110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bra04147]
    BRADO3110
Enzymes [BR:bra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BRADO3110
Exosome [BR:bra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRADO3110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAL76912
RhizoBase: BRADO3110
UniProt: A4YSN6
Position
3307594..3308796
Genome map
AA seq 400 aa AA seqDB search
MGDRETFGRDSMTASIVGWAHTPFGKFDAETVESLVVKVANEALADAGIAAGDVDEIVLG
HFNAGFSPQDFTASLVLQADPALRFKPATRVENACATGSAAVHQGIRAIAAGAAKIVLVV
GVEQMTRTPGPEIGKNLLKASYLPEDGDTVGGFAGVFGKIAQGYFQKYGDQSDALALIAA
KNHKNGVANPFAQMRKDFGFEFCRSESEKNPYVAGPLKRTDCSLVSDGAAALVLTDSETA
KKFAKAVNVRATAHAQDFLPMSKRDILAFEGCTVAWQRALEKAGVTLSDLSFVETHDCFT
VAELIEYEAMGLTPRGQGARAIKEGWTLKDGKLPVNPSGGLKAKGHPIGATGVSMHVMTA
MQLTGTAPEGMQLPNAKLGGIFNMGGAAVANYVSILEPAK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ttgggggacagggagacattcgggagagacagcatgaccgccagcatcgtcggatgggcg
catacgccgttcggaaagttcgacgccgagaccgtcgagagcctcgtcgtcaaggtcgcc
aatgaggcgctggcggatgccggcattgcggccggcgacgtcgacgagatcgtgctcggc
catttcaatgccggcttctcgccccaggacttcaccgcctcgctggtgctgcaggccgat
ccggcgctgcgcttcaagccggcgacgcgggtcgagaacgcctgcgccaccggttctgct
gccgtccaccagggcatccgcgccatcgcggccggtgccgcgaagatcgtcctcgtcgtc
ggcgtcgagcagatgacgcggacgccgggtccggagatcggcaagaacctgctgaaagcc
tcctacctgccggaggacggcgacaccgtcggcggcttcgccggcgtgttcggcaagatc
gcgcagggctatttccagaaatatggcgaccagtccgatgcgctggcgctgatcgccgcc
aagaaccacaagaacggcgtcgccaacccgttcgcgcagatgcgcaaggatttcggcttc
gagttctgccgctccgagagcgagaagaacccgtacgtcgccggccccctgaagcgcacg
gactgctcgctggtctccgacggcgccgccgcgctggtgttgaccgacagcgagaccgcc
aagaaattcgccaaggcggtgaacgtccgcgcgaccgcgcatgcgcaggacttcctgccg
atgagcaagcgcgacatcctcgccttcgagggctgcacggtggcctggcagcgtgcgctg
gagaaggccggcgtcacgctgtccgatctctccttcgtcgagacccatgactgcttcacc
gtcgccgagctgatcgagtacgaggcgatgggcctcacgcccagggggcagggtgcccgc
gccatcaaggaaggctggacgctcaaggacggcaagctgccggtcaatccctccggcggc
ctcaaggccaagggccacccgatcggcgccaccggcgtctcgatgcacgtgatgaccgcc
atgcagctcaccggcacggcgcccgagggcatgcagctccccaacgccaagctcggcggc
atcttcaacatgggcggcgccgcggtggcgaactacgtctcgatcctggagccggcgaag
tag

DBGET integrated database retrieval system