KEGG   Bradyrhizobium sp. ORS 278: BRADO4107Help
Entry
BRADO4107         CDS       T00516                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase (TIM) (Triose-phosphate isomerase)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00010  Glycolysis / Gluconeogenesis
bra00051  Fructose and mannose metabolism
bra00562  Inositol phosphate metabolism
bra00710  Carbon fixation in photosynthetic organisms
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01120  Microbial metabolism in diverse environments
bra01130  Biosynthesis of antibiotics
bra01200  Carbon metabolism
bra01230  Biosynthesis of amino acids
Module
bra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bra_M00002  Glycolysis, core module involving three-carbon compounds
bra_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO4107 (tpiA)
   00051 Fructose and mannose metabolism
    BRADO4107 (tpiA)
   00562 Inositol phosphate metabolism
    BRADO4107 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRADO4107 (tpiA)
Enzymes [BR:bra01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BRADO4107 (tpiA)
Exosome [BR:bra04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BRADO4107 (tpiA)
  Exosomal proteins of bladder cancer cells
   BRADO4107 (tpiA)
  Exosomal proteins of melanoma cells
   BRADO4107 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAL77859
RhizoBase: BRADO4107
UniProt: A4YVD3
Position
complement(4296215..4296970)
Genome map
AA seq 251 aa AA seqDB search
MTDRIRPLIAGNWKMNGLKASAAEFEAMLAGAAEVTGKADLLVCPPATLLAAFAEKTRGG
KAVAVGAQDCHAKASGAHTGDISAEMLADAGASAVIVGHSERRADHGESDVVVHQKAEAA
WRAGLVAIVCVGETQQQRDAGLTLEILRGQLTLSLPEGSRADNLIVAYEPVWAIGTGLTP
TAGDVEQIHSFIRQLLIVRFKEQGARMRILYGGSVKPSNAAELMAVANVNGALVGGASLK
AADFLAIAKGC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcatccggcccctgatcgccggcaattggaaaatgaatggcctcaaggcg
tcggccgcggagttcgaggccatgctcgcgggggcggccgaggtcaccggcaaggccgac
ctcttggtatgccccccggccacgctgctggcggcgtttgccgagaagacgcgcggcggc
aaggcggtcgcggtcggggcgcaggattgccacgccaaggcgtcgggcgcccatacgggc
gacatctcggccgagatgctggcggatgccggggccagcgccgtcatcgtgggccattcg
gagcggcgggccgaccatggcgagagcgatgtcgtcgtgcaccagaaggccgaggcggcg
tggcgcgccgggctggtcgcgatcgtctgcgtcggcgagacccagcagcagcgcgacgcc
gggctgaccctggagatcttgcgcgggcagctcaccctcagcctgccggagggttcgcgg
gccgacaatctgatcgtggcctatgagccggtctgggcgatcggcaccgggctgacgccg
accgccggggatgtcgagcagattcattcctttatccggcaattgctgatcgttcggttc
aaggagcagggggcgcggatgcggatcctctatggtggctcggtcaagccgtccaatgcg
gccgagctgatggcggtggccaacgtcaatggtgcgctggtcggcggcgcgagcctgaaa
gcagcagactttctcgcaattgcgaaaggctgttga

DBGET integrated database retrieval system