KEGG   Bradyrhizobium sp. ORS 278: BRADO4110Help
Entry
BRADO4110         CDS       T00516                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase (IGPS)
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01130  Biosynthesis of antibiotics
bra01230  Biosynthesis of amino acids
Module
bra_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BRADO4110 (trpC)
Enzymes [BR:bra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BRADO4110 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAL77862
RhizoBase: BRADO4110
UniProt: A4YVD6
Position
4300155..4300973
Genome map
AA seq 272 aa AA seqDB search
MSDILAKIEAYKREEIAAAKQACPLSELEARAREASAPRGFVKALRSKHASGDYALIAEV
KKASPSKGLIRADFDPPVLARAYEAGGAACLSVLTDTPSFQGHLDFMVAARAATALPVLR
KDFMFDTYQVIEARAHGADCILIIMAALDDAAAADIEMAALDSGMDVLIEIHDRAELDRA
LKLRSPMIGINNRNLRTFETTLATSESLAPLVPKERLLVGESGIFTPADLSRLAQVDIQT
FLVGESLMRQADVTAATRALLARNAASASAAE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacatcctggccaagatcgaagcctataagcgcgaggagatcgcggctgccaag
caggcttgtccgctgtcggaactcgaggcacgcgcacgcgaggcgtcggcgccgcgcggc
ttcgtcaaggccctccgcagcaagcatgccagcggcgactatgctttgatcgccgaggtg
aagaaggcgtcgccgtcgaagggcctgatccgcgccgatttcgatccgcccgttcttgcc
agggcttatgaggccggcggcgccgcctgtctgtcggtgctgaccgatacgccctcgttc
cagggccatctcgacttcatggtcgccgcgcgcgccgcgaccgccctgcccgtgctgcgc
aaggacttcatgttcgacacctaccaggtcatcgaggcgcgggcgcatggcgccgattgc
attctcatcatcatggcggcgctcgacgacgcggctgctgctgacatcgagatggcggcg
ctcgatagcgggatggacgtgctgatcgagattcacgaccgcgccgaactcgaccgcgcg
ctgaagctgcgctcgccgatgatcggcatcaacaaccgcaacctgcgcacgttcgagacc
accctcgccacgtccgagtctttggcgccgttggtgccgaaggagcgtctgctggtcggc
gagagcggcatcttcaccccggcggatctgtcgcgcctggcgcaagtcgacatccagacc
ttcctggtcggcgagagcctgatgcgccaagccgacgtcaccgcggcgacgcgcgccctg
ctcgcgcgcaacgccgcctcggcaagcgcggctgagtga

DBGET integrated database retrieval system