KEGG   Bradyrhizobium sp. ORS 278: BRADO4793Help
Entry
BRADO4793         CDS       T00516                                 

Gene name
fucA
Definition
(GenBank) L-fuculose-1-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00051  Fructose and mannose metabolism
bra01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BRADO4793 (fucA)
Enzymes [BR:bra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BRADO4793 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: CAL78519
RhizoBase: BRADO4793
UniProt: A4YX93
Position
complement(4989925..4990713)
Genome map
AA seq 262 aa AA seqDB search
MNREERQLRETIIAKCRWMNASGLNQGTSGNISARYKDRMLITPSATPYDSMKPEMIASM
PLDGEYGSWEGPLKPSTEWRFHLDIMRGRPDVGGVVHTHSTYATVLAIARKPIPACHYMM
AAFGGTDIRCAGYARFGTAELSELALEALKGRNGCLLANHGMIAVGANLDKAMWLAVELE
TIAKQYYLSLALGQPHILGDAEIAETAQGFSTYGLQDQKTTKSAKPVKKAVKVAAKPAAK
AGTKTRAAAARRKPETKRSATR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcgaggaacgacagctccgcgagaccatcatcgccaagtgccggtggatgaac
gcctcgggtctgaatcagggcacgtccggcaatatctcggcccgctacaaggaccgaatg
ctgattacgccgtcggcgacaccctatgattcgatgaagccggagatgatcgcatcgatg
ccgctcgacggcgaatatggctcctgggaagggccgttgaagccgtcgacggaatggcgc
ttccatctggacatcatgcgcggacgcccggatgtcggcggcgtcgtgcatacgcattcg
acctacgccaccgtgcttgcgattgcgcgcaagccgattccggcctgccactacatgatg
gcggcgttcggcggcaccgacatccgttgcgccggctatgcgcgtttcggcacggccgaa
ctgtccgagctggcgctggaagcgctgaagggacgcaacggctgcctgctcgccaaccat
ggcatgatcgccgtcggcgccaatctcgacaaggcgatgtggctcgcggtcgagctcgag
accatcgcgaagcagtattatctttcgctcgcgctgggacagccgcacatcctgggcgat
gccgagatcgccgagacggcgcagggcttttcgacctacgggctgcaggaccagaagacg
acaaagtcagcgaagcccgtcaagaaggcggtcaaggttgctgccaagccagctgccaaa
gccggcaccaagacgcgtgcggccgcagcccggcgcaagcccgagacgaagcgtagcgcg
acgcgatga

DBGET integrated database retrieval system