KEGG   Bradyrhizobium sp. ORS 278: BRADO4917Help
Entry
BRADO4917         CDS       T00516                                 

Definition
(GenBank) putative Alpha-ribazole phosphatase (anaerobic pathway of cobalamin biosynthesis, cobC)
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00860  Porphyrin and chlorophyll metabolism
bra01100  Metabolic pathways
Module
bra_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BRADO4917
Enzymes [BR:bra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     BRADO4917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 QueT
Motif
Other DBs
NCBI-ProteinID: CAL78629
RhizoBase: BRADO4917
UniProt: A4YXK3
Position
complement(5117189..5117782)
Genome map
AA seq 197 aa AA seqDB search
MRLDLLRHGTTGRNGHLDGRTDPPLSEAGWEQFRRQTRSGEWSRVVSSPLMRARAAADEY
ARQAGCALQVDPDWSELHFGQWDGRKRSDIVSEPEQAALLDAFYADPLVAAPGGESWADL
QVRVSRAVDRILATAEPAAVLVVTHGGAIRAALSHLLGWPLPQLWSLRIHPGTRLTLEAG
HGPDGAPWAEIVEIIQP
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcgacctgctgcggcatggcaccaccgggcgcaacggccatctcgacggccgc
accgatcccccgctgagcgaggcgggttgggagcaattccggcggcagactcgaagcggg
gaatggagccgggtcgtgagttccccattgatgcgagcgcgggcggcggcggacgaatat
gcccgacaggccggctgcgcgctgcaggttgatccagattggagcgaactgcatttcgga
caatgggacgggcgcaagcgcagcgacatcgtgagtgaaccggagcaggccgccttgctc
gatgccttctacgcggatcccttggtcgccgcacccggcggcgagagctgggccgatctg
caagtacgggtgtcgcgcgccgtggatcgcatcctcgcgacggcggagcctgcggcggtt
ctggtcgtcacgcatggcggcgcgatccgcgctgcgctgtcgcatctgctcggctggccc
ttgcctcaactctggagcttgcgcattcatcccggcacccgtctgacgctcgaggctggg
cacggcccggatggcgcgccgtgggccgaaatcgtcgagatcatccagccatga

DBGET integrated database retrieval system