KEGG   Bradyrhizobium sp. ORS 278: BRADO5356Help
Entry
BRADO5356         CDS       T00516                                 

Gene name
phnG
Definition
(GenBank) PhnG protein
  KO
K06166  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG [EC:2.7.8.37]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00440  Phosphonate and phosphinate metabolism
bra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BRADO5356 (phnG)
Enzymes [BR:bra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     BRADO5356 (phnG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhnG
Motif
Other DBs
NCBI-ProteinID: CAL79035
RhizoBase: BRADO5356
UniProt: A4YYQ9
Position
complement(5563847..5564302)
Genome map
AA seq 151 aa AA seqDB search
MSGDTALQERRKGAMRVLAHVPSADIGTRMAEVTVPPHRELRAAESGLVMVRGRVGGDGA
PFNLGEATVSRAAIRLDSGEVGFGYVLGRDSDKARLIALCDALLQSPEHAQAIETKVVAP
LRAQLRADQQRSAAEAAATRVDFYTMVRGEG
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgacacggcgttgcaggagaggcggaagggagcgatgcgcgtgctcgcgcat
gttccttctgctgacatcgggacgcgaatggctgaagtgacggtgccgccgcatcgggag
ctccgggccgccgagagcggtctggtcatggtgcgcggccgtgtcggcggcgatggcgcg
ccgttcaatctgggcgaggcgaccgtgtcccgtgcggccatccggctcgacagcggcgag
gtcggtttcggctatgtgctcgggcgtgacagcgacaaggcgcggctgatcgcgctgtgc
gatgcgctgctgcagtcgcctgagcatgcccaggcaattgagaccaaggttgtggctccc
ctgcgcgcgcagctgcgggcggatcagcagcggagcgcagcggaggccgcggctacgcgc
gtcgatttctacaccatggtgcggggagaaggctga

DBGET integrated database retrieval system