KEGG   Bradyrhizobium sp. ORS 278: BRADO6774Help
Entry
BRADO6774         CDS       T00516                                 

Gene name
apaG
Definition
(GenBank) ApaG protein; unknown function
  KO
K06195  ApaG protein
Organism
bra  Bradyrhizobium sp. ORS 278
Brite
KEGG Orthology (KO) [BR:bra00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BRADO6774 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4962
Motif
Other DBs
NCBI-ProteinID: CAL80372
RhizoBase: BRADO6774
UniProt: A4Z2J6
Position
7033048..7033440
Genome map
AA seq 130 aa AA seqDB search
MYRAVTRHIEVTVEPNFLPEKSSVADGRWFWSYTVVITNSGAETVQLRSRHWVITDGAGR
QQEVRGEGVVGEQPVLAPGERFEYTSGVPLSTASGFMSGSYQMESASGEQFDIVVPAFSL
DSPDGKRVLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtgccgtgactcgccacatcgaagtgaccgtcgagccgaacttcctgccagag
aagtcgtcggtcgccgatggccgctggttctggtcctacaccgtggtcatcaccaatagc
ggcgcggagacggtacagctgcgcagccggcactgggtcatcaccgacggtgccggccgg
cagcaggaggtccgcggcgagggcgtcgtcggcgagcagccggttctcgcaccgggcgag
cgcttcgaatacacctccggcgtcccgctctccaccgcctccggcttcatgtccggctcc
taccagatggagagcgccagcggcgagcagttcgacatcgtggtgcctgcgttctcgctg
gacagccccgatggcaagcgggtgttgaactag

DBGET integrated database retrieval system