KEGG   Bradyrhizobium sp. BF49: BF49_1169Help
Entry
BF49_1169         CDS       T04337                                 

Definition
(GenBank) AspartyltRNAAsn amidotransferase subunit A EC 6356 GlutamyltRNAGln amidotransferase subunit A EC 6357
  KO
K01426  amidase [EC:3.5.1.4]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00330  Arginine and proline metabolism
brad00360  Phenylalanine metabolism
brad00380  Tryptophan metabolism
brad00627  Aminobenzoate degradation
brad00643  Styrene degradation
brad01100  Metabolic pathways
brad01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BF49_1169
   00360 Phenylalanine metabolism
    BF49_1169
   00380 Tryptophan metabolism
    BF49_1169
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BF49_1169
   00643 Styrene degradation
    BF49_1169
Enzymes [BR:brad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BF49_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CUT10089
UniProt: A0A160U6E6
Position
I:1208250..1209752
Genome map
AA seq 500 aa AA seqDB search
MEIVMPPGLTATDWDYGSISTLLSALHARKLSASELIEHTIARIEALDGRINAVIVRDFD
RARDAARAADTALGRGERLPLLGIPVTLKEPFNVAGLPTTWGFPHFRDFQPAEDALVVSR
LKAAGAVIIGKTNIPIGLRDFQSYNEIYGTTNNPWDLGRSPGGSSGGSGAALAAGFGPLS
IGSDIGGSIRVPAHFCGVFGHKPSLGPVPLRGYSLPPAPPVPGQGDLAVVGPMTRTASDL
ALALDVIAGPDETRDGIGYRLALPAPRHDQLRDFRILVIDTHPLMPTGDAVRSAIGRLSE
RLERSGARVSRSSPSLPDLAESARLYMKLLNAARTPRLTPAALAEAQGVAAALSPDDRSL
QAERARGWAMVHREWLATDAARLQLQQEWQRFFREFDAVIYPAAAVPAFPQDQSEPFDAR
QLDIDGQLYRYADACFIWADPASTCGLPATAVPIERTPTGLPIGVQIIGPYLEDRTTIAL
AGLIERAFGGFVPPPSLAAK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgtgatgccgcccggattgaccgccactgactgggactacggctcgatcagc
acattgctgagcgccctgcacgcgcgcaagctttctgcgtcggagttgatcgagcatacg
atcgcgcgcatcgaggcgctggacgggcggatcaatgccgtcatcgttcgcgatttcgat
cgcgcacgagacgccgcgcgcgccgccgataccgcgcttggccggggcgagcgcctgccg
ttgctcggcatccccgtgacgttgaaagaaccgttcaacgtcgccggcctgccgacgaca
tggggctttccgcatttcagggatttccaaccggcggaggacgcccttgtcgtctcgcgg
ttgaaggcggcgggcgctgtcatcatcggcaagaccaatatcccgatcggtctcagagat
ttccagagctacaatgagatctacgggacgacgaacaatccgtgggatctcggccgatcg
cccggcggctcttcaggcggatcgggcgcggcgctggctgcggggttcggtccgctctcg
atcggctcggatatcggcggctcgatccgggtgcccgcgcatttctgtggtgtgttcgga
cataagccgagcctcggcccggtcccgctgcgcggatacagcctgccgccggcgccgccg
gtgcctggccagggcgatctggccgtcgtcgggccgatgacgcgcaccgcctcggatctt
gcgctcgcgctcgacgtgatcgccggccccgacgagacacgcgacgggatcggctaccgt
cttgcgttgccggccccgcgccacgaccagctcagggatttcaggatcctcgtgatcgat
acgcatccgttgatgccgacgggcgatgccgtgcgttccgccatcgggcggctgtctgaa
cggctcgaacgatcaggcgcccgggtttcgcgctcgagcccatcgctgcccgacctcgcc
gaatccgcgaggctctacatgaagctgctgaacgcggcgcgaactccacgcctgacacct
gccgccctcgcggaggcgcaaggagttgccgcggcactttcgcccgacgaccgcagcctg
caggccgagcgggcgcgcggctgggcgatggtccatcgtgaatggctggcgaccgatgcg
gcgcgcctgcagctccagcaggagtggcagcgattcttccgcgagttcgacgcagtgatc
tacccggccgccgccgtgccggcctttccacaggaccagtccgagccgttcgacgcgcga
caactggatatcgatggacagctctatcggtacgccgatgcgtgcttcatctgggcagac
cccgcttcgacctgcggactgcctgcgaccgctgttccgatcgagcgcacgcctacgggc
ctgccgatcggcgtccagatcatcgggccttatctcgaggatcgcaccacgattgcgctc
gctgggctgatcgaacgcgcgttcggcggcttcgtcccgccgccgtcgttggctgcaaag
taa

DBGET integrated database retrieval system