KEGG   Bradyrhizobium sp. BF49: BF49_1756Help
Entry
BF49_1756         CDS       T04337                                 

Definition
(GenBank) COGs COG0183
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00071  Fatty acid degradation
brad00072  Synthesis and degradation of ketone bodies
brad00280  Valine, leucine and isoleucine degradation
brad00310  Lysine degradation
brad00362  Benzoate degradation
brad00380  Tryptophan metabolism
brad00620  Pyruvate metabolism
brad00630  Glyoxylate and dicarboxylate metabolism
brad00640  Propanoate metabolism
brad00650  Butanoate metabolism
brad00900  Terpenoid backbone biosynthesis
brad01100  Metabolic pathways
brad01110  Biosynthesis of secondary metabolites
brad01120  Microbial metabolism in diverse environments
brad01130  Biosynthesis of antibiotics
brad01200  Carbon metabolism
brad01212  Fatty acid metabolism
brad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BF49_1756
   00630 Glyoxylate and dicarboxylate metabolism
    BF49_1756
   00640 Propanoate metabolism
    BF49_1756
   00650 Butanoate metabolism
    BF49_1756
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BF49_1756
   00072 Synthesis and degradation of ketone bodies
    BF49_1756
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BF49_1756
   00310 Lysine degradation
    BF49_1756
   00380 Tryptophan metabolism
    BF49_1756
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BF49_1756
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BF49_1756
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BF49_1756
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:brad04147]
    BF49_1756
Enzymes [BR:brad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BF49_1756
Exosome [BR:brad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BF49_1756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OB_aCoA_assoc
Motif
Other DBs
NCBI-ProteinID: CUT10676
UniProt: A0A160U8M3
Position
I:1829236..1830753
Genome map
AA seq 505 aa AA seqDB search
MTSSTIPEDRIPVIVGVGEIVDRPKEITEGLEPLDLLEQALLSAEADAGAKLLGEVQSLD
VVNFLSWRYRDPEQLLAQRLGIKPSHCYYGPVGGESPIRYIHEAAKRIARGECSVAAVCG
AEAQSTATKAERAGAKLPWTSFAHDVEEPKRGAAYQKPLAVKLGVFRPVTVYPFYEAASS
AHWGQTPREAMAESGVLWSRYSEAAAQNPNAWLKRRYAPEEITTPTADNRLIAWPYNKLM
VANPSVNMGGALLLTSLARARAAGIAEDKLVYPLGGASAEEPRDYLLRDQFYESHPQNAV
LKAAMDLAGGDGKKFDAIELYSCFPCVPKMARRTLGLSADVQPTVTGGLTFFGAPLNTYM
THAACAMVRRVRDGATLGLLYGQGGFVTKHHALVVSKVPPREALAQETSVQAAADGNKRA
VPEFVSDVSGKGKVESFTVLYGRAGDVEHGVVMLRTEDDRRTLARIPASDAATLAHLLDM
NRTPVGSLGEITMAADGLPEWRVGK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccagctccaccatccccgaagaccgcatccccgtcatcgtcggcgtcggcgagatt
gtcgaccgccccaaggagatcaccgagggcctcgaaccgctcgacctgctcgaacaggcc
ttgctgagcgcggaagcagatgccggcgcgaagttgctcggcgaggtgcaatcgctcgac
gtcgtcaacttcctgagctggcgttatcgcgatccggagcagttgctggcgcagcggctc
ggcatcaagccgtcgcattgctattacggcccggtcggcggcgagagcccgatccgctac
atccacgaagcggcaaagcgcattgcgcgcggtgaatgcagtgttgccgcagtttgcggc
gcggaggcacagtcgacggcgaccaaggcggagcgcgccggcgcgaagctgccatggacg
tcgttcgcccatgacgtcgaggagccgaaacgcggcgcggcgtaccagaagccgctggcg
gtgaagctcggcgtgttccggccggtcacggtgtatccgttctacgaggcggcatcgtcc
gcccattggggccagacaccgcgcgaggcgatggcggagtcaggcgtgctgtggtcgcgc
tattcggaagccgccgcgcaaaatccaaatgcctggctgaagcggcgctatgcgccggag
gagatcacgacgccgacggcggacaaccgcctgatcgcctggccctacaacaagctcatg
gttgcgaaccccagcgtcaacatgggcggcgcgctgctgctcaccagcctcgccagggcg
cgtgcggcaggcatcgccgaggacaagctcgtctacccgctaggcggcgcttcggcggaa
gaaccgcgcgactatctcttgcgtgaccagttttacgaaagccatccgcagaacgccgtc
ttgaaggctgcgatggatctcgccggcggcgacggaaagaaattcgacgcgatcgagctc
tatagctgcttcccgtgcgtgcccaagatggcgcggcgaacgctgggcctttccgccgac
gtgcagccgaccgtaacaggcggcctcaccttcttcggcgcaccgctcaacacctacatg
acgcacgcggcttgcgcgatggtgcggcgggtgcgcgacggcgcaacgctcggcctgctt
tacggccagggcggcttcgtcaccaagcatcatgcactggtggtgtcgaaggtcccgccg
cgtgaagcattggctcaggagacgagcgtgcaggcggcggcggacggcaacaagcgcgcg
gtgccggaattcgtctcggatgtctcgggcaagggcaaggtcgagagctttacggtgctc
tacggccgggccggcgatgtcgagcacggcgtggtgatgctgcggacggaagacgacagg
cgcacgctggcgcggattcccgcgagcgacgcggcgacactggcgcatctgctcgacatg
aacaggacgccggtgggttcgcttggcgagatcacgatggctgcggatggcctgccggag
tggcgggtggggaagtag

DBGET integrated database retrieval system