KEGG   Bradyrhizobium sp. BF49: BF49_2112Help
Entry
BF49_2112         CDS       T04337                                 

Definition
(GenBank) 34dihydroxy2butanone 4phosphate synthase EC 419912 GTP cyclohydrolase II EC 35425
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00740  Riboflavin metabolism
brad00790  Folate biosynthesis
brad01100  Metabolic pathways
brad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BF49_2112
   00790 Folate biosynthesis
    BF49_2112
Enzymes [BR:brad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BF49_2112
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     BF49_2112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: CUT11032
UniProt: A0A160U6E8
Position
I:complement(2225319..2226395)
Genome map
AA seq 358 aa AA seqDB search
MPDNVQEVLQAFARGELVVVTDDDDREGEGDLIVAASFCTAEKMAFIIRHTSGIVCAPIT
TEDARRLRLDPMVAHNDSAHTTAFTVSIDYKPDGGTGISAEERASCCRALSNPNAGANDF
ARPGHIFPLIAKDGGVLLRSGHTEAAVDLCKLSGLPPVGVISELMNDDGSVMKGEQVARF
AAQHKLKHVTIADMIAYRQVREKLIERVSTFVTESPIGPLQGYAYRSPFDSIAHVAFVYN
GVGDGKNVLTRFHKPNIVKDIFTGHKRMAAVLEHFKKSGRGVLVYLRDGAAGVPVAPLPD
ESATEADRNRQWREVGVGAQILRDLGVTSIRHLTSSVHDYKGLSGFGIEIVANELLES
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgccggataacgtccaggaagtcttgcaggcctttgcccggggtgagctcgtggtcgtc
accgacgacgatgatcgcgagggcgagggcgatctgatcgtcgccgcctcgttctgcacc
gccgagaagatggcgttcatcatccgccacacctccggcatcgtttgcgcgccgatcacg
accgaagatgcgcgccgcctgcggctcgatccgatggtggcccacaacgattcagcgcac
actaccgcattcacggtctcgatcgactacaagcccgacggcggcaccggcatctcggcc
gaggagcgcgcctcctgctgccgcgcgctgtccaatcccaacgccggcgccaacgacttc
gcccgtcccggccacatcttcccgctgatcgccaaggacggcggcgtgttgctgcgctcc
ggccataccgaggccgcggtcgacctgtgcaagctctccggcctgccgccggtcggcgtc
atcagcgagttgatgaacgacgacggcagcgtgatgaaaggcgagcaggtcgcccgcttc
gccgcccagcacaagctcaagcacgtcaccatcgccgacatgatcgcctatcgccaggtg
cgcgagaagctgatcgagcgggtctcgaccttcgtcaccgagagcccgatcgggccgctg
cagggctatgcctaccgctcgccgttcgattccatcgcccacgtcgccttcgtctacaac
ggcgtcggcgacggcaagaacgtcctgacacgcttccacaagcccaacatcgtcaaggac
atcttcaccggccacaagcgcatggcggcggtgctcgagcacttcaagaaatccggccgt
ggcgttctggtctatctgcgcgacggtgcggccggtgtccccgtggcgccgctgcccgat
gagagcgcgaccgaggctgaccgcaaccggcagtggcgcgaagtcggcgtcggtgcacag
atcctgcgcgatctcggcgtcacctcgatccggcatctcacctcctcggtgcacgactac
aaggggctttcgggcttcggcatcgagatcgtcgccaacgagctgctcgaaagttag

DBGET integrated database retrieval system