KEGG   Bradyrhizobium sp. BF49: BF49_3959Help
Entry
BF49_3959         CDS       T04337                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase ATP EC 41149
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00010  Glycolysis / Gluconeogenesis
brad00020  Citrate cycle (TCA cycle)
brad00620  Pyruvate metabolism
brad00710  Carbon fixation in photosynthetic organisms
brad01100  Metabolic pathways
brad01110  Biosynthesis of secondary metabolites
brad01120  Microbial metabolism in diverse environments
brad01130  Biosynthesis of antibiotics
brad01200  Carbon metabolism
Module
brad_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF49_3959
   00020 Citrate cycle (TCA cycle)
    BF49_3959
   00620 Pyruvate metabolism
    BF49_3959
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BF49_3959
Enzymes [BR:brad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     BF49_3959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: CUT12879
UniProt: A0A160UCF9
Position
I:4067569..4069185
Genome map
AA seq 538 aa AA seqDB search
MQETGVRNGAFGADKFGLKNLKQVHWNLGAPQLYQYSLSAGEAVLSADGALCADTGEFTG
RSPKDKFTVRDATTDKKMWWAGNQSITAEQFETLYQDFLKHAEGKSLFAQDLYGGADPAY
RIKTRVFTELAWHSLFIRTLLIRPEAIELSAFVPELTIIDMPSFRADPKRHGCKSENVVA
IDFARKIVLIGGSYYAGEMKKSVFTTLNYYLPERGVMPMHCSANVGAKGDAAIFFGLSGT
GKTTLSADPNRTLIGDDEHGWGPNGVFNFEGGCYAKCIKLSQEAEPEIYAASTRFGAVLE
NCVLDEDTRVVDFDDGSKTENTRSAYPLEFIPNASRTGRAPQPKNVVMLAADAFGVLPPI
AKLSPAQAMYHFLSGYTAKVAGTERGLGNEPQPEFSTCFGSPFLPLDPSVYGNMLRDLIA
QHNVDCWLVNTGWTGGKYGTGSRMPIKVTRALLTAALDGSLRNVQFRTDKYFGFAVPTAL
PGVPSEILNPVNTWKDKDEFDKTARALVGMFQKNFAKFEAQVDAEVRAAAPDVKLAAE
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagagacgggcgtgcgcaacggtgccttcggcgccgacaaattcggcttaaagaat
ctcaagcaggttcactggaacctcggtgcgccgcaactctatcaatactcactctcggcg
ggcgaggcggtgctgtcggccgatggcgcgctctgcgccgacaccggcgagtttaccggc
cgcagccccaaggacaaattcacggtgcgtgacgccaccaccgacaagaagatgtggtgg
gccggcaaccagtcgatcaccgcagagcagttcgagacgctctaccaggacttcctcaag
catgccgaaggcaagtcgctgttcgcacaggacctctatggcggcgccgatccggcttat
cgcatcaagacccgcgtcttcaccgagctcgcctggcactcgctgttcatccgcacgctg
ctgatccgtcccgaggcgatcgagctctcggcgttcgtgcccgagctcaccatcatcgac
atgccgagcttccgcgccgatccgaagcgccatggctgcaagtcggagaacgtcgtcgcg
atcgatttcgcccgcaagatcgtgctgatcggcgggtcttactatgccggcgagatgaag
aagtcggtcttcaccacgctgaactactatctgcccgagcgcggcgtgatgccgatgcat
tgctcggccaatgtcggcgccaagggcgatgccgcaatcttcttcggcctctccggcacc
ggcaagaccacgctgtcagccgatccgaaccgcacgctgatcggcgatgacgagcacggc
tggggcccgaacggcgtcttcaatttcgaaggcggctgctacgccaagtgcatcaagctg
tcgcaggaagccgagcccgagatctatgccgcctcgacccgcttcggtgcagtactcgag
aactgcgtgctcgacgaagacacccgcgtggtcgatttcgacgacggctccaagaccgag
aacacgcgttcggcctatccgctcgaattcatcccgaacgcctcgcgcaccggccgcgcg
ccgcagcccaagaacgtggtgatgctcgccgccgacgcctttggcgtgctgccgccgatc
gccaagctctcgccggcgcaggcgatgtatcacttcctgtcgggctacaccgcgaaggtc
gcgggcaccgagcgcggtctcggcaacgagccgcagccggaattctcgacctgcttcggt
tcgcccttcctgccgctcgaccccagcgtctatggcaacatgctgcgcgacctgatcgcc
cagcacaatgtcgattgctggctggtcaacacggggtggaccggcggcaagtacggcacc
ggctcgcgcatgccgatcaaggtgacgcgcgcgctgctgaccgcggcgctcgacggctcg
cttcgcaacgtccaattccgcaccgacaaatatttcggcttcgcggtcccgaccgcgctg
ccgggcgtgccgagcgagatcctcaacccggtcaacacgtggaaggacaaggacgagttc
gacaagaccgcccgcgcgctggtcggcatgttccagaagaactttgccaagttcgaagcc
caggtcgacgccgaagtccgcgccgcagcgccggacgtgaagctcgcggcggagtaa

DBGET integrated database retrieval system