KEGG   Bradyrhizobium sp. BF49: BF49_4348Help
Entry
BF49_4348         CDS       T04337                                 

Definition
(GenBank) Glucose 1dehydrogenase EC 11147
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00030  Pentose phosphate pathway
brad01100  Metabolic pathways
brad01120  Microbial metabolism in diverse environments
brad01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BF49_4348
Enzymes [BR:brad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     BF49_4348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: CUT13268
UniProt: A0A161K3B2
Position
I:4484843..4485679
Genome map
AA seq 278 aa AA seqDB search
MPHTDRSTTFSSRLVGQYALVTGASQGIGRAVTIRLAQEGATVAINYVDHPEKAEETLAL
ARTASSDRGHGRLDHAIVKADVSNEQEVAAMFETVLARWKRLDCLVNNAGFQRESPSEAL
DVDTYRRIIDVNLNGAVLCAQKALAHFVARGAGGSIINCSSVHQIIPKPGYLAYSISKGG
MANLTRTLALEFAGRGIRVNAVGPGAIDTPINAAWTGDPEKRGVVTSHIPLGRVGTPEEI
AAVFAFLASDEASYITGQTIYACGGLTLFPEFRDNWAS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgccacatactgaccgctcgaccaccttttcctcgcgcctcgtcggccaatacgcgctg
gtgaccggcgcctcccaaggcatcgggcgcgccgtcaccatccggctcgctcaggaaggc
gcgaccgtcgccatcaactatgtcgatcatcccgaaaaggcagaggagacgctcgcgctg
gcacggacggcatcgagcgatcggggccacggcaggctcgatcatgccatcgtcaaggcc
gacgtgagcaatgagcaggaggtcgccgcgatgttcgagacggttttggcgcgctggaag
cgcctcgactgtctcgtcaacaatgccggcttccagcgggaatcgccgagcgaggcgctc
gacgtcgacacctatcgccgcatcatcgacgtcaatctcaacggcgccgtgctctgcgcg
cagaaggcgctcgcgcatttcgtcgcgcggggcgcaggcggcagcatcatcaactgctcc
agcgtgcaccagatcatcccgaaacccggctacctcgcttactcgatcagcaagggcggc
atggccaatctaacgcgtacgctggcgctcgaatttgccggccgtggcattcgcgtcaat
gcggtcggtcccggcgcgatcgacacgccgatcaacgcggcctggaccggcgatccggaa
aagcgcggcgtggtcaccagccacattccgctcggccgcgtcggtacaccggaagagatc
gccgccgtgttcgccttcctcgcctcggatgaagccagctacatcacggggcagaccatc
tacgcctgcgggggcctgacgctgtttcccgagtttcgggacaattgggcgagctag

DBGET integrated database retrieval system