KEGG   Bradyrhizobium sp. BF49: BF49_6048Help
Entry
BF49_6048         CDS       T04337                                 

Definition
(GenBank) Amidase EC 3514
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00970  Aminoacyl-tRNA biosynthesis
brad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brad00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BF49_6048
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:brad03029]
    BF49_6048
Enzymes [BR:brad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BF49_6048
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BF49_6048
Mitochondrial biogenesis [BR:brad03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BF49_6048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CUT14968
UniProt: A0A161K3W8
Position
I:complement(6213027..6214448)
Genome map
AA seq 473 aa AA seqDB search
MHKKGVEEEVTSLHDLSAVDLIAGYRAKQFSPSEVLEDVLAHVAAWEPHLKALYAFDPDG
AREAAKASTARWSGGEPSGALDGVPVTVKDNIATKGVPVPLGAASVKLVPAEKDAPPAAR
LREAGAIIFAKTTMPDYGMLSSGLSSFHALARNPWDLSKNPGGSSAGAGAAAAAGYGPLH
LGTDIGGSVRLPAGWCGLVGLKPSFGRVPIDPTYVGRVAGPMTRTVDDCALMMSVIAKPD
RRDGTSLPAEPLNWKVPEKSPRKLRIGLMLDPGVGLALEKPVREVAVKAAKAFESAGAVV
TEVDGILTREMLDGLDNFWRARMWDDLSKLTPAEQAKVLPYIFKWGESGAKLSGVDVIRG
FNQTMAIRAAASKLFCELDYVISPTAPNVNYPAEWASPTNDPMKPFEHIAYTVPWNMSEN
PAISINGGFDPKGFPIGVQIVGRRFDDIGVLGMAKAFESLRGPQKPWPSPPAK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaaagggtgtcgaagaggaagtcacctcgctgcacgatctctccgcggtcgac
ctgatcgcgggctatcgcgccaagcagttctcgccgagcgaggtgctggaagacgtactc
gcgcacgtcgccgcgtgggagccgcacctcaaggcgctttatgcatttgatcccgacggt
gcgcgcgaggccgcgaaggcctcgaccgcacgctggtccgggggcgagccgtccggcgcg
ctcgacggcgtgccggtgacggtgaaggacaatatcgcgaccaagggcgtgccggtgccg
ctgggcgcggccagcgtcaagctcgtgccggccgagaaggacgcaccaccggccgcgcgc
ctgcgcgaggccggtgcgatcatcttcgccaagaccaccatgcccgattacggcatgctg
tcctcggggctctccagctttcatgcgctcgcgcgcaatccctgggacctctccaagaat
cccggcggctccagcgccggcgcgggcgccgcggcggcggccggctatggtccgctgcat
ctcgggaccgatatcggcggctcggtccggctgcccgcgggctggtgcggccttgtcggg
ttgaaaccgagctttggccgcgtgccgatcgatcccacctacgtcggccgcgtcgccggt
cccatgacccgcacagtcgacgattgcgcgctgatgatgagcgtgatcgcaaaacccgac
cggcgcgacggcacgagcctgcccgcggagcccctcaactggaaggtgccggagaaatcc
ccgcgcaaactccgcatcggattgatgctcgatcccggcgttggcctggcgctggagaaa
ccagtgcgcgaggtcgctgtgaaggcggcgaaagcgttcgaatccgcaggggccgtcgtc
accgaggtcgacggcatcctcacgcgcgagatgctcgacggcctcgacaacttttggcgc
gcacggatgtgggatgatctgtcgaagctgacgcccgccgaacaggcaaaggtgctgccc
tacattttcaagtggggcgaatccggcgcgaagctctcgggtgtcgacgtcatcaggggc
ttcaaccagaccatggcaatccgcgctgcggcatcaaagctgttctgcgagctcgactat
gtgatctcgccgaccgcgccgaacgtgaactatccggcggagtgggcctcgccgaccaac
gatcccatgaagccgttcgaacacatcgcctataccgtgccatggaatatgtcggaaaat
ccggcgatctccattaacggcggcttcgaccccaagggttttcccatcggcgtgcagatc
gtcggccgccgcttcgacgatatcggcgtgcttggcatggccaaggcatttgaaagcctg
cgcgggccgcagaagccctggccgagccctccggcgaagtaa

DBGET integrated database retrieval system