KEGG   Bradyrhizobium sp. BF49: BF49_6990Help
Entry
BF49_6990         CDS       T04337                                 

Definition
(GenBank) MethionyltRNA synthetase EC 61110
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00450  Selenocompound metabolism
brad00970  Aminoacyl-tRNA biosynthesis
brad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BF49_6990
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BF49_6990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:brad01007]
    BF49_6990
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:brad03016]
    BF49_6990
Enzymes [BR:brad01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BF49_6990
Amino acid related enzymes [BR:brad01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BF49_6990
Transfer RNA biogenesis [BR:brad03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BF49_6990
 Prokaryotic type
   Other AARSs
    BF49_6990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: CUT15910
UniProt: A0A160UIG7
Position
I:7132549..7134567
Genome map
AA seq 672 aa AA seqDB search
MAARAKKIAKGKSSKKKAATKAVKKAAKKAVKARARKAAKKVKKATKTKKTAAKKSGKKA
VKKSAGKTAKKAAKKPVVAKKTVKTATKKPAKASAKNKASAKNKAPAKTIAKTARVAAPA
VTTTLALVATPPKIAKPKAPRAPKSDAGPQATTPVAVPARDNVFYITTAIAYPNGSPHIG
HAYEAIATDTLARFARLDGKDVFFLTGTDEHGQKMVQTAASEKMSVSELAARNAGRFKQM
DERLNVSFDRFIRTTEEQHHRSSQEIWRRMEANGDIYVDIYAGWYSVRDEAYYAEDETRL
NDDGVRLGPQGTPVEWVEEKSYFFRLSAYQDRLLKLYETQPNFIGPDSRKNEVVSFVRGG
LRDLSISRTTFDWGVKVPGDEEHVMYVWVDALTNYITGVGFPEESDNNWRYWPADVHIIG
KDIIRFHAVYWPAFLLSAGIPLPKRVYAHGFLFSRGEKMSKSVGNVVDPFNLADQYGVDQ
MRYFFLREVPFGQDGNYNHEAIVARINADLANDLGNLAQRSLSMIAKQLGGVLPDPGEFS
DNDKAILSQADGMLAASREAMATQQIHHWLNAVWAVVAEANRYFAGEAPWALAKTDPVRQ
RTVLYVTAEVVRQIAILAQPAMPTASGLLLDSLGIPEEERNFAALGGATRIAPGTTLPAP
TPAFPRYIEPAA
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcgcgagctaagaaaatcgctaagggcaagagcagcaagaagaaggctgccacg
aaggccgtcaagaaagccgcgaagaaggccgtgaaggcgcgcgcgcgcaaagctgccaag
aaggtcaagaaagccacgaagaccaaaaagacggccgccaagaaatccgggaagaaggct
gtgaagaagagcgccgggaagacggcaaagaaggcagcgaagaagccggtcgtcgccaag
aagacggtcaagacagcgaccaaaaagcctgccaaggcttcggcaaaaaacaaggcttcg
gcgaaaaacaaggcaccggcgaagacgatagccaagacggcgagggtggctgcgcctgcc
gtgaccaccacactagctcttgtcgccacgccgccgaaaattgccaagcccaaggccccg
cgcgcaccgaagtccgacgccgggccgcaggccaccacgcccgtggccgtgcccgcgcgc
gacaacgtcttctacatcacgaccgcgatcgcctatcccaatggcagcccccatatcggc
cacgcctatgaggcgatcgcgaccgatacgttggcgcgcttcgcgcgactcgacggcaag
gatgtgttcttcctgaccggcaccgacgagcacggccagaagatggttcagaccgcggcc
agcgaaaaaatgtccgtctcggagctcgccgcccgcaatgccggccgtttcaagcaaatg
gacgagcgcctgaacgtgtcgttcgaccgcttcatccgcaccaccgaggagcagcatcat
cgctccagccaggagatctggcggcgcatggaagcgaacggggacatctatgtcgacatc
tatgccggctggtattccgtgcgtgatgaagcctattacgccgaggacgagacacgcctg
aacgacgacggtgtgcggctcgggccacagggcacgccggtcgaatgggtcgaggagaag
agctacttcttccgcctgtcggcctatcaggacaggctgctcaagctatatgagacgcag
cccaatttcatcggccccgactcccgcaagaacgaggtggtgagcttcgtacgaggcggc
ctgcgcgatctctcgatctcgcgcacgacgttcgactggggcgtcaaggtgcccggcgac
gaagagcacgtgatgtatgtctgggtcgacgcgctcaccaactacatcaccggcgtcggc
ttccccgaggagagcgacaacaactggcgttattggcctgccgacgtgcacatcatcggc
aaggacatcatccgcttccatgcggtgtactggccggctttcctgctgtcggccgggatc
ccgctaccgaagcgggtctatgcccatggcttcctgttcagcaggggcgagaagatgtcg
aagtcggtcggcaacgtggtcgatcccttcaacctcgccgaccagtacggcgtcgaccag
atgcgctatttctttctgcgcgaggtgccgttcggccaggacggcaactacaatcacgag
gccatcgtcgcgcgcatcaatgccgatctcgccaacgatctcggcaacctcgcgcagcgc
tcgctgtcgatgatcgccaagcagctcggcggcgtgctcccggatcccggcgaattcagc
gacaacgacaaggcgatcctgtcacaagccgacggcatgctcgcggcgtcccgcgaagcg
atggcgacgcagcaaatccatcactggctcaatgccgtgtgggccgtggtcgcggaagcc
aaccgctatttcgcgggcgaagcgccgtgggcgctcgccaagaccgatcctgtcaggcag
aggacggtgctctacgtcaccgccgaagtcgtgcgccagatcgcgatcctggcccagccg
gccatgccgacggcctcgggattgctgctggacagcctcggtatccccgaagaggagcgc
aacttcgctgcgctcggcggcgcgacgcgcatcgcgcccggtacgacgctgcccgcgccg
acgccggccttcccgcgctacatcgagccggcagcctaa

DBGET integrated database retrieval system