KEGG   Brenneria rubrifaciens: EH207_14420Help
Entry
EH207_14420       CDS       T05976                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
brb  Brenneria rubrifaciens
Brite
KEGG Orthology (KO) [BR:brb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EH207_14420 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF3699
Motif
Other DBs
NCBI-ProteinID: QCR09609
UniProt: A0A4P8QVT4
Position
3186646..3187023
Genome map
AA seq 125 aa AA seqDB search
MINAPRVCVQVQSFYVESQSQPDEERFVFAYTITVRNLGRHPVRLLGRYWLITNANGRQT
EVQGEGVVGEQPLIPPGSEFQYTSGTVLETPLGTMEGHYQMVDQQGDTFQVSIPVFRLAI
PSLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgcgccccgtgtttgtgtacaggttcaaagcttctacgttgagtcgcagtca
caacccgatgaagaacgttttgtctttgcctataccatcactgtccgcaatctggggcgg
catccggtgcgtttgctaggccgctactggctcattaccaatgccaacggccgtcagact
gaagttcaaggcgagggcgtggtcggcgaacaaccgctgatcccccccggtagcgaattt
cagtataccagcggcacggtgctggaaacgccgctggggacaatggaaggtcactaccag
atggtcgatcaacaaggcgacacctttcaggtcagcatccctgtctttcgtctggccatt
ccctcactgatacattaa

DBGET integrated database retrieval system