KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_10755Help
Entry
BCCGELA001_10755  CDS       T04273                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00900  Terpenoid backbone biosynthesis
brc01110  Biosynthesis of secondary metabolites
brc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:brc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCCGELA001_10755
Enzymes [BR:brc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     BCCGELA001_10755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AMA61176
UniProt: A0A109QD15
Position
2279433..2280746
Genome map
AA seq 437 aa AA seqDB search
MAGGPEVGKRPRQINSRLENLRNLSPAQRLGRVTEATSLGEVESKAFSAGTLPVELANGM
IENVIGTFELPVGIATNFTVNGRDYLVPMAIEEPSVVAAASYMARIARKCGGFHTSSTGP
IMRAQVQVLGVTDVHGARARVLKERSGIIEAANARDKVLISLGGGCRDIEVHIFEETPVG
PMLAVHLIVDVRDAMGANTVNTMAETVAPIVERITGGTVRLRILSNYADLRIARAMVSVT
PEALNTDEYSGERVARGIVEACAFAIVDPYRAATHNKGIMNGVDPVVVATGNDWRAIEAG
AHVWASRSGRYTSLSNWEIDNKGNLVGTLEMPMALGLVGGATKTHPAARAALKILNVQSA
QELAEVTVAVGLAQNMGALRALATEGIQKGHMALHARNIAIVAGAEGDEIEKVAAALAAD
HDVRVDRAREVLEKLRS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggccggaggacccgaggtgggcaagcggcccaggcagatcaactcgcgattggagaac
cttcgcaacctctcgcccgcgcagcggctggggcgcgtgaccgaggcgacgtcacttggc
gaagtcgagagcaaggcatttagcgccggcacgctgccggtcgaactcgccaatggcatg
atagagaacgtcatcggcaccttcgaactgcctgtcggcatcgcaacaaacttcacggtg
aacggccgcgactatctggttccgatggccatcgaggagccctcggtcgtcgccgccgcc
tcctacatggcgcgcattgcccgcaaatgcggcggcttccacacctccagcaccggtccg
atcatgcgcgcacaggtgcaggtgctcggcgtgaccgatgtccacggcgcccgcgcgcgg
gtactgaaggagcgctcgggcatcatcgaggctgccaacgccagggacaaggtgctgatc
tcgctcggcggcggctgccgcgacatcgaggttcacatcttcgaggagacgccggtcggc
ccgatgctcgccgtgcatctcatcgtcgacgttcgcgatgcgatgggtgccaacacagtc
aatacgatggcagagacggtcgcgccgatcgtcgagcggattaccggcggcacggtgcgc
ctgcgcatcctttcgaactatgcggatctacgcatcgcccgcgccatggtatcggtgacg
ccggaggcgctgaacacagatgaatacagcggcgagcgcgtcgcgcgcggcatcgtcgag
gcgtgcgccttcgcgattgtcgacccctaccgtgccgcgacccacaataagggcatcatg
aacggtgtcgatccggtcgtcgtggccaccggcaacgactggcgtgcgatcgaggcgggc
gcccatgtttgggcttcacgctccggccgctatacgtcgctctccaactgggaaatcgat
aacaagggcaacctcgtcggcacgctggaaatgccgatggcgctcgggctcgtcggcggc
gccaccaagacacatcccgccgcgcgcgctgcgctgaagatcctgaacgtgcagagtgca
caggaactggcggaggtcaccgtcgcggtcgggctcgcccagaacatgggcgcgctccgc
gcgcttgcgaccgagggtatccagaaagggcacatggcgctccacgccaggaacatcgcg
atcgttgcaggggccgagggcgatgagatcgagaaggtcgcggcggcgctcgccgccgat
cacgacgtgcgcgtcgatcgcgccagggaggttttggaaaagttgcgttcgtga

DBGET integrated database retrieval system