KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_21560Help
Entry
BCCGELA001_21560  CDS       T04273                                 

Gene name
gatA
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00970  Aminoacyl-tRNA biosynthesis
brc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCCGELA001_21560 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:brc03029]
    BCCGELA001_21560 (gatA)
Enzymes [BR:brc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BCCGELA001_21560 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BCCGELA001_21560 (gatA)
Mitochondrial biogenesis [BR:brc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BCCGELA001_21560 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AMA58599
UniProt: A0A120HNH6
Position
complement(4661889..4663364)
Genome map
AA seq 491 aa AA seqDB search
MTDLTSLTLAEARKGLADKTFTSLELTDAHLSAIEAARVLNAFVMETPDQARAMAKAVDE
KIAKGEGGPLAGIPLGIKDLFATKGVRTTACSKILDNFVPTYESTVTSQLWRDGAVMLGK
LNNDEFAMGSANETSCFGPVGNPWRREGSNTTLVPGGSSGGSASAVAALLCMGATATDTG
GSIRQPAAFTATVGIKPTYGRCSRWGIVAFASSLDQAGPIARSVRDAAMLLRSMAGHDPK
DTTSVDIPVPDYEAAIGKSVKGMKIGIPKEYRLDGMPGEIEKLWSEGAAWLKAAGAELVE
VSLPHTKYALPAYYIVAPAEASSNLARYDGVRYGLRESGKNIIEQYENTRAEGFGAEVRR
RVMIGTYVLSAGYYDAYYLRAQKVRTLIKKDFEDCFARGVDAILTPATPSAAFGIGEKGG
ADPVEMYLNDIFTVTVNMAGLPGIAVPAGKDAQGLPLGLQLIGRPFDEETLFSLGDVIEQ
AAGRFTPARWW
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttgacatcgctgacgctcgccgaggcccgcaagggtctcgccgacaagact
ttcacgtcactcgagctgaccgacgcgcatctttccgcgatcgaggccgcgcgcgtgctc
aatgccttcgtgatggagacgccggaccaggcgcgcgccatggccaaggccgtggacgag
aagatcgccaagggtgagggcgggccgctcgccggcatcccgctcggcatcaaggatctg
ttcgcgaccaagggcgtgcgcaccacggcctgctcgaagatcctcgacaatttcgtgccg
acctatgagtccaccgtcacctcgcagctctggcgcgacggcgcggtgatgctcggcaag
ctcaacaatgacgagttcgcgatgggctcggcaaacgagacctcgtgcttcggccctgtc
ggcaatccctggcggcgcgagggaagcaacacgacactggtgccgggcggctcgtccggc
ggctcggcctcggcggtggcggcgctgctctgcatgggcgcgaccgcaaccgataccggc
ggctcgatccgccagccggctgcgttcaccgcaaccgtcggcatcaagccgacctatggc
cgctgctcgcgctggggcatcgtcgcgtttgcctcctcgctcgatcaggccggtccgatc
gcacgcagcgtgcgcgatgccgcaatgctgctgcgctcgatggccggccacgatccgaag
gacacgacctccgtcgacatccccgtgcctgactacgaggccgcgatcggcaagtccgta
aagggtatgaagatcggcatccccaaggagtatcgtctcgacggcatgccgggcgagatc
gagaagctgtggagcgagggcgcagcgtggctgaaggcggccggcgccgagctcgtcgag
gtgtcgctgccgcataccaaatacgcgctgccggcttattatatcgtggcccctgccgag
gcctcgtccaacctcgcgcgctatgacggcgtgcgctacggcctgcgcgagtccggtaag
aacatcatcgagcagtacgagaacacccgcgccgaaggttttggcgcggaggtgcgccgc
cgtgtcatgatcggcacctatgtgctctcggcgggctattatgatgcgtattacttgcgg
gcccagaaggtgcgcactctgatcaagaaggattttgaggattgtttcgcgaggggcgtc
gacgcgatcctcacgccggcaacaccgtcggcggccttcggcatcggagagaagggcggt
gcagaccccgtcgagatgtatctcaacgacatcttcacggtgacggtgaacatggcgggc
ctgccgggcattgccgtgcccgcgggtaaggacgcgcagggcctgccgctcggcttgcaa
ctgatcggccgtcccttcgacgaggaaacgctgttctcgctcggcgacgtcatcgagcag
gccgccggccgcttcacgcccgcgaggtggtggtga

DBGET integrated database retrieval system