KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_21570Help
Entry
BCCGELA001_21570  CDS       T04273                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00970  Aminoacyl-tRNA biosynthesis
brc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCCGELA001_21570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:brc03029]
    BCCGELA001_21570
Enzymes [BR:brc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BCCGELA001_21570
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BCCGELA001_21570
Mitochondrial biogenesis [BR:brc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BCCGELA001_21570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln PTA_PTB
Motif
Other DBs
NCBI-ProteinID: AMA58601
UniProt: A0A120HNH4
Position
complement(4663598..4663885)
Genome map
AA seq 95 aa AA seqDB search
MSVDAATVRRIAHLARIAVSEDEVPHLQGELNAMLAFVEQLSEVNVEGVEPMTSVTPMQM
KKRQDVVNDGEIADDIVANAPATEGHFFLVPKVVE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgacgccgctaccgtccgccgcatcgcgcatctggcgcgcattgcggtttcc
gaggacgaggttccgcatctgcagggcgagctcaacgccatgctcgccttcgtcgagcag
ctctcggaggtcaatgtcgagggcgtggagccgatgacctcggtcaccccgatgcagatg
aagaagcggcaagacgtggtcaatgacggcgagatcgccgacgatatcgttgccaacgcg
cccgcgaccgaaggccatttcttcctggtgccgaaggtcgtcgagtaa

DBGET integrated database retrieval system