KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_25230Help
Entry
BCCGELA001_25230  CDS       T04273                                 

Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00540  Lipopolysaccharide biosynthesis
brc01100  Metabolic pathways
Module
brc_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:brc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BCCGELA001_25230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:brc01005]
    BCCGELA001_25230
Enzymes [BR:brc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     BCCGELA001_25230
Lipopolysaccharide biosynthesis proteins [BR:brc01005]
 Unusual sugar
  BCCGELA001_25230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR
Motif
Other DBs
NCBI-ProteinID: AMA59244
UniProt: A0A109QBU8
Position
complement(5404386..5405366)
Genome map
AA seq 326 aa AA seqDB search
MLLVTGGAGFIGSNVVAALNEAGRSDVVVCDLLGDEGKWRNLAKRQLVDIVPPAELLDWL
KGRKLEAMIHLGAISETTATDGDLVIETNFRLSMRLLNWCAANAVPFIYASSAATYGDGA
DGFDDDASLPALKKLRPMNLYGWSKHLFDLAVAERVARGDQLPPQWAGLKFFNVFGPNEY
HKGSMMSVLARRFEDVKAGRVVQLFKSHRDGIDHGDQRRDFIYVDDVVRVVMWLLATPSV
SGLFNVGTGKARSFRDLMLAAYAALGKNPNIEYIDMPESIRNSYQYFTQSKVDHLHRAGY
NGGFTTLEDAVKAYVGDYLDRPDRFR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgttgctggtgaccggtggggccggttttatcgggtcgaatgtcgtcgccgcgctgaac
gaggccggccgcagcgacgtcgtcgtgtgcgatctgctcggcgacgagggcaaatggcgg
aacctcgccaagcgccagcttgtggatatcgtgcccccggccgagctgctggattggctg
aagggccgcaagttagaggccatgattcatctcggggcgatctccgagaccaccgcgacc
gacggcgatctcgtgatcgagaccaatttccgcctgtcgatgcgccttctgaactggtgc
gcggcgaatgcggtcccgttcatttatgcttcctcggcggcgacttatggcgatggcgcg
gatggtttcgacgatgacgcctcgctgccggcgctgaagaagctgcggccgatgaatctg
tacggctggagcaagcacctgttcgacctcgccgtcgccgaacgggtcgcgcgcggcgat
cagctcccgccgcaatgggccggactaaaattcttcaacgtgttcgggcccaacgaatat
cacaagggctcgatgatgagcgtgctggcgcgtcgcttcgaggacgtcaaagcgggccgc
gtcgtgcagctgttcaagtcgcaccgcgacggcatcgaccacggcgaccagcgccgcgat
ttcatctatgtcgacgatgtcgtgcgcgtcgtcatgtggctgctggcgacgccgtcggta
tccggcctgttcaacgtcgggaccggcaaggcgcgtagcttccgggatttgatgctggca
gcctatgccgcgctcggcaaaaatcccaacatcgaatatatcgacatgcccgaaagcatc
cgcaacagctaccaatatttcacccagagcaaggtcgatcacctccatcgcgccggttat
aacggcggcttcacgacgctcgaggatgcggtgaaggcttatgtcggcgattatctcgac
cggcccgaccgcttccgctga

DBGET integrated database retrieval system