KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_26510Help
Entry
BCCGELA001_26510  CDS       T04273                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00071  Fatty acid degradation
brc00072  Synthesis and degradation of ketone bodies
brc00280  Valine, leucine and isoleucine degradation
brc00310  Lysine degradation
brc00362  Benzoate degradation
brc00380  Tryptophan metabolism
brc00620  Pyruvate metabolism
brc00630  Glyoxylate and dicarboxylate metabolism
brc00640  Propanoate metabolism
brc00650  Butanoate metabolism
brc00900  Terpenoid backbone biosynthesis
brc01100  Metabolic pathways
brc01110  Biosynthesis of secondary metabolites
brc01120  Microbial metabolism in diverse environments
brc01130  Biosynthesis of antibiotics
brc01200  Carbon metabolism
brc01212  Fatty acid metabolism
brc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:brc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCCGELA001_26510
   00630 Glyoxylate and dicarboxylate metabolism
    BCCGELA001_26510
   00640 Propanoate metabolism
    BCCGELA001_26510
   00650 Butanoate metabolism
    BCCGELA001_26510
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCCGELA001_26510
   00072 Synthesis and degradation of ketone bodies
    BCCGELA001_26510
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCCGELA001_26510
   00310 Lysine degradation
    BCCGELA001_26510
   00380 Tryptophan metabolism
    BCCGELA001_26510
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCCGELA001_26510
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCCGELA001_26510
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCCGELA001_26510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:brc04147]
    BCCGELA001_26510
Enzymes [BR:brc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCCGELA001_26510
Exosome [BR:brc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCCGELA001_26510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AMA59469
UniProt: A0A109QBZ0
Position
complement(5681252..5682484)
Genome map
AA seq 410 aa AA seqDB search
MADALIIDACRTPRGVGKAGKGALSGIHPQQLGATVLRALADRTGINTADVDDIVWGCSA
QVATQGGDLGRMSALDAGYDVRASAVTLDRFCGSGITSVNMAASSIMAGAEDLVIAGGCE
MMSMEGRRGGGPMMMDSGNLRLRARHPQSHQGVCADAIATLEGIIRQDVDALGLESQKRA
AHAMANGHFKKSLVPVHREDGSLALDHEEYPRPQTTMEGLSSLKPAFPAIADYALDDKGT
TYRGLILQKYPDLDIDFVHHAGNSSGVVDGAAAILLASPAYAKAHGLKARARVVAMANMG
DSPTLMLNAPVPATRKVLAKAGLSIDDIDLFEINEAFAVVAEKYIRDLKLDRDKVNVNGG
SIALGHPIGATGSILIGTVLDELERRDLKRGLVTMCAAGGMAPAIIIERI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcgctgatcatcgatgcctgccggaccccgcgcggcgtcggcaaggccggc
aagggagcactctcgggcattcatccgcagcagctcggtgcaaccgtgctgcgcgcgctc
gccgatcgcaccggcatcaatactgccgatgtcgacgacatcgtctggggctgcagcgcg
caggtcgccacccaaggcggcgatctcgggcgcatgtcggcgctcgatgccggctacgac
gtgcgcgccagcgccgtgacgctcgaccgcttctgcggaagcggcatcaccagcgtcaac
atggccgcaagctcgatcatggcgggcgcggaagacctcgtcattgccggcggctgcgag
atgatgtcgatggagggacgacgcggcggcggtccgatgatgatggattccggcaatctg
cgcctgcgggcgaggcatccgcagtcgcatcagggcgtctgtgccgatgcgatcgcgacg
ctcgaaggcatcattcgacaggatgtcgacgcgctcggcctggagagccagaagcgcgcc
gcgcatgcgatggcgaacggtcacttcaagaagagcctcgtccccgtccaccgcgaggat
ggcagcctcgcgctcgaccacgaggagtatccgcggccgcagaccacgatggagggcttg
agcagcctgaagccggcattccccgcgatcgccgattatgcgctcgacgacaagggcacg
acctatcgcggcctgatcctgcaaaaatatccggatctcgacatcgacttcgtgcatcac
gccggcaactcgtccggcgtcgtcgacggtgccgcggcgatcctgctggcctcgcccgcc
tacgccaaggcacatggtctcaaagcccgcgcccgcgtggtggcgatggcgaacatgggg
gactcgcccacgctgatgctgaatgcgccggtgccggcgacgcgcaaggttctggcgaag
gcgggcctttccatcgacgacatcgacctgttcgaaatcaacgaggcctttgcagtagtt
gcggaaaaatatatccgcgacctcaagctcgaccgcgacaaggtcaacgtcaacggcggc
tcgatcgcgctcggccatccgatcggcgccaccggctcgatcctgatcggcaccgtgctc
gacgagctcgaacggcgcgatctcaagcgcggtctggtcaccatgtgcgccgccggcggc
atggcgccggccatcatcatcgagcgcatctag

DBGET integrated database retrieval system