KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_27185Help
Entry
BCCGELA001_27185  CDS       T04273                                 

Definition
(GenBank) phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00030  Pentose phosphate pathway
brc00710  Carbon fixation in photosynthetic organisms
brc01100  Metabolic pathways
brc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:brc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BCCGELA001_27185
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BCCGELA001_27185
Enzymes [BR:brc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     BCCGELA001_27185
    4.1.2.22  fructose-6-phosphate phosphoketolase
     BCCGELA001_27185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AMA61505
UniProt: A0A0X8CQA4
Position
5826230..5828644
Genome map
AA seq 804 aa AA seqDB search
MTNQQQSRAASSDLDLLDRYWRAANYLSVGQIYLLDNPLLREPLRPEHIKPRLLGHWGTT
PGLNFIYAHLNRVIRALDLSVIYICGPGHGGPGMVANTYLEGSYSEIYPEIARDADGLRK
LFRQFSFPGGIPSHAAPETPGSIHEGGELGYALVHAYGAAFDNPDLIVACVVGDGEAETG
PLAASWHSNKFLNPAHDGAVLPILHLNGYKIANPTVLGRMRDEEIRNLFRGFGHEPLFVE
GDDPRLMHQSMADALDVALASIRSIRQHARDGRTTIERPRWPMIVLRSPKGWTGPKEVDG
KKVEGFWRAHQVPVSGCRDNPAHLKVLEDWMRSYEPDKLFDSSGALIPELQALAPDGPRR
MGANPHANGGLLKKELKLPDFRSFAVEVPQPGGVIAEATRELGKFLRDVIRLNAKERNFR
IMGPDETASNRLDAVFEATERVWMEPTEPYDVHLAQDGRVMEVLSEHLCQGWLEGYLLTG
RHGFFSCYEAFIHIVDSMFNQHAKWLKVTRELPWRRPIASLNYLLTSHVWRQDHNGFSHQ
DPGFVDLVANKKADIVRIYFPPDANTLLWIADHCLRTYNRINVIVAGKQPAPQWLSMQDA
ATHCDAGIGIWSWAGTEDASAEPDVVMACAGDVPTLETLAAVDLLRKALPDLKIRVVNVV
DLMTLQPREQHPHGLSGRDFDGLFTADKPVIFAYHGYPYLIHRLTYNRTNHAGMHVRGFA
EEGTTTTPFDMVVLNKLDRYHLAIEAIERVPGLATKAAGIKQQFRDKLIEHARYVREHGE
DMPEVQGWVWPNSSGGNTPAEAGD
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaacaacaatcgcgagcggcgagcagcgacctcgatctgctcgatcgctat
tggcgcgctgcgaactacctttccgtcgggcagatctacctgctcgacaatccgctgctg
cgcgagccgctgcggcccgagcacatcaagccgcgcttgctcggccattggggcacgacg
cccgggttgaacttcatctatgcccatctcaatcgcgtgatccgcgcgctggacctcagc
gtgatctacatctgcggccccggccatggcggcccgggcatggtcgccaacacctatctc
gaaggcagctacagcgagatctatcccgaaatcgcccgcgatgcggacggattgcgcaag
ctgttcaggcagttctccttccccggcggcattccgagccacgcggcgcccgagacgcca
gggtcgatccacgagggcggcgagctcggctatgcgctggtgcacgcctatggcgccgcc
ttcgacaatcctgacctgatcgtggcctgcgtcgtcggcgacggcgaggcagagaccggt
ccgctcgctgcgtcctggcactccaacaagttcctcaacccggcccatgacggcgcggtg
ctgccgatcctgcatctcaacggctacaagatcgccaaccctaccgtgctcgggcggatg
cgggacgaggaaattcgcaatctcttccgcggcttcggccacgagccgctgttcgtcgaa
ggcgacgatcccagattgatgcaccagtccatggcggacgcgctcgacgtggcgctcgcc
agcattcgctcgatccggcagcatgcccgcgatggacgcacgacgatcgagcggccgcgc
tggccgatgatcgtgctgcgcagtcccaagggctggaccgggccgaaagaggttgacggc
aagaaggtcgaaggcttctggcgtgcgcaccaggttcccgtttcaggctgccgcgacaac
ccggcgcaccttaaagtgctcgaagactggatgcgcagctacgagccggacaagctgttc
gactcgagcggcgcactgattcccgagcttcaggcgctggcacccgacggcccgcggcgg
atgggcgccaatccgcacgccaatggcgggctcctgaagaaagagctgaaactgccggac
ttccgcagcttcgccgtggaggtgccgcagcccggcggcgtcatcgccgaagccacgcgc
gagctcggcaaattcctgcgcgacgtcatccgcctcaacgccaaggagcgcaacttccgc
atcatgggcccggacgagaccgcgtcaaaccggctggacgcggtgttcgaggccaccgaa
cgcgtctggatggagccgaccgagccctacgacgtgcatctcgcgcaggacgggcgtgtg
atggaggtgctcagcgagcatctctgccagggctggctcgagggctatctgctcaccggc
aggcatggcttcttctcctgctacgaggctttcatccacatcgtcgattccatgttcaac
cagcatgccaaatggctgaaggtgacgcgcgaattgccgtggcgccgcccgatcgcctcg
ctcaattatctcctgacttcgcatgtctggcgccaggaccataacggcttcagccaccag
gaccctggtttcgtcgatctcgtcgccaacaagaaggccgatatcgtccgcatctatttc
cccccggacgctaacacgctgctgtggatcgccgatcactgcctgcgcacctacaaccgc
atcaacgtgatcgtcgccggcaagcagccggcgccgcaatggctgtcgatgcaggatgcg
gccacgcattgcgatgccggcatcggcatctggagctgggcgggcacggaggatgcgagt
gcagagcccgacgtcgtgatggcctgcgccggcgacgtgccgacattggaaacgctcgcc
gccgtcgacctcctgcgcaaggcgctgccggacctgaaaatccgcgtcgtcaacgtcgtc
gacctgatgacgctgcaaccgagggaacagcatccgcacggcctctccggccgcgacttc
gacggcctgttcacagcggacaagcctgtcatcttcgcctatcacggctacccctatctc
attcaccggctgacctataatcgcaccaaccatgccggcatgcatgtgcgcggctttgcc
gaggaaggcaccacaacgacgccgttcgacatggtcgtgctcaacaagctcgaccgctac
cacctcgccatcgaggcgatcgagcgcgtgcctggtctcgcgaccaaagcggcggggatc
aagcagcaattccgcgacaagctgatcgagcacgcccgctatgtccgcgagcacggcgag
gacatgcccgaggttcagggctgggtctggccgaacagttccggcggcaacacgccggcc
gaagccggcgactga

DBGET integrated database retrieval system