KEGG   Brevundimonas sp. DS20: JL11_01410Help
Entry
JL11_01410        CDS       T04101                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
brd  Brevundimonas sp. DS20
Pathway
brd00071  Fatty acid degradation
brd00072  Synthesis and degradation of ketone bodies
brd00280  Valine, leucine and isoleucine degradation
brd00310  Lysine degradation
brd00362  Benzoate degradation
brd00380  Tryptophan metabolism
brd00620  Pyruvate metabolism
brd00630  Glyoxylate and dicarboxylate metabolism
brd00640  Propanoate metabolism
brd00650  Butanoate metabolism
brd00900  Terpenoid backbone biosynthesis
brd01100  Metabolic pathways
brd01110  Biosynthesis of secondary metabolites
brd01120  Microbial metabolism in diverse environments
brd01130  Biosynthesis of antibiotics
brd01200  Carbon metabolism
brd01212  Fatty acid metabolism
brd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:brd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JL11_01410
   00630 Glyoxylate and dicarboxylate metabolism
    JL11_01410
   00640 Propanoate metabolism
    JL11_01410
   00650 Butanoate metabolism
    JL11_01410
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JL11_01410
   00072 Synthesis and degradation of ketone bodies
    JL11_01410
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JL11_01410
   00310 Lysine degradation
    JL11_01410
   00380 Tryptophan metabolism
    JL11_01410
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JL11_01410
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JL11_01410
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JL11_01410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:brd04147]
    JL11_01410
Enzymes [BR:brd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JL11_01410
Exosome [BR:brd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JL11_01410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt CMD
Motif
Other DBs
NCBI-ProteinID: ALJ07142
UniProt: A0A0P0D270
Position
294781..295983
Genome map
AA seq 400 aa AA seqDB search
MREAVIVSTARTPIGRAYRGAFNDTQAQQLGAHAVRHAVQRAGVEPAEIEDVIMGAALQQ
GSTGTNVARQVALAAGLPSSVPGMSLDRQCASGLMAIATAAKQVIFDQQKMAVGGGLESI
SLVQNQYINLYRGKDEALLKLAPHIYMSMLETAEVVARRYNISRDRQDEYALQSQQRTAA
AQAEGRLDAEIVPMTTTMLVTDKATGETASKEVTLSKDEGNRPETTLEGLKALKPVFGSG
EAIQQGEYITAGNASQLSDGASACVIMEAGEAVKRNLQPLGAYRGMAVAGVEPDEMGIGP
VYAVPKLLKRHGLTVDDIGIWELNEAFAVQVLYCRDTLGIPDELLNVSGGAISIGHPYGM
SGARMTGHVLIEGKRRGAKYGVVTMCVGGGMGAAGLFEIY
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaagccgtcatcgtctccaccgcccgcaccccgataggccgggcctatcgcggg
gccttcaacgacacccaggcccaacagctgggcgcccatgccgtcagacacgcggtccag
cgcgccggcgtcgagccggccgagatcgaggacgtgatcatgggcgcggccctgcagcag
ggctcgaccggaaccaatgtcgcccgccaggtcgccctggcggccggtctgccgtcttcg
gttccgggcatgagcctggatcgtcaatgcgcctcgggcctgatggccatcgccacggcg
gccaaacaggtgatcttcgaccagcagaagatggcggtcggcggcgggctggagagcatc
tccctggtccagaaccagtatataaacctgtaccgcggcaaggacgaggccctgctgaag
ctggcgccccatatatatatgtcgatgctggagacggccgaggtcgtggcccgccgctac
aacatcagccgcgaccgccaggacgaatacgcccttcagtcccagcagcgcacggcggcg
gcccaggcggaagggcgactggacgccgagatcgtgcccatgacgaccaccatgctggtc
acggacaaggccaccggcgagaccgcttcgaaagaggtgaccctgtccaaggacgagggc
aaccggcccgaaaccactctggaagggttgaaggcgctgaaacccgtcttcggcagcggc
gaggcgatccagcagggcgaatacatcaccgccggcaatgcgtcccagttgtccgacggc
gcctcggcctgtgtgatcatggaggccggcgaggcggtgaaacgcaatcttcagccgctc
ggcgcctatcgcggcatggcggtggcgggggtggagccggacgagatgggcatcggcccc
gtctacgccgtgcccaaattgctgaagcgccacgggctgacggtggacgacatcggcatc
tgggagctgaacgaggccttcgccgtccaggttctctattgtcgcgacaccctgggcatc
cccgacgagctgctgaacgtctcaggcggcgccatctccatcggccacccctatggcatg
tcgggcgcccggatgaccggccacgtcctgatcgagggcaagcggcgcggggccaaatac
ggcgtcgtcaccatgtgcgtcggcggcggcatgggcgcggcggggctgttcgagatttat
taa

DBGET integrated database retrieval system