KEGG   Brevundimonas sp. DS20: JL11_02290Help
Entry
JL11_02290        CDS       T04101                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
brd  Brevundimonas sp. DS20
Brite
KEGG Orthology (KO) [BR:brd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    JL11_02290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LTD
Motif
Other DBs
NCBI-ProteinID: ALJ07301
UniProt: A0A0P0CLY8
Position
complement(469185..469592)
Genome map
AA seq 135 aa AA seqDB search
MHDGPAYTAETNGILIRVRPSYLAGQSDPDEGRWVWAYQVEIVNLSGTTVQLMARRWTIT
DGHGHVEEVRGPGVVGEQPVIEPGGSYAYASGCPLPTDSGSMVGAYYMTDAEGRSFEVDI
PAFSLDTPGARRVLN
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatggtcctgcctataccgccgaaacgaacggcatactgatccgggtccggccc
tcctatctggcgggccagtcggacccggacgagggtcgctgggtctgggcctatcaggtc
gagatcgtgaacctgagcgggacgacggtccagctgatggcgcgccgctggaccatcacc
gacggccacggccatgtcgaggaggtgcgcggcccgggcgtggtgggcgaacagccggtg
atcgagccgggcggcagctatgcctacgcctcgggttgtcccctgccgaccgacagcggg
tccatggtcggagcctattatatgaccgacgcggaggggcgcagtttcgaggtggatatc
ccggccttctcgctggatacgcccggtgcaagacgggtgttgaactga

DBGET integrated database retrieval system