KEGG   Brevundimonas sp. MF30-B: E4M01_02280
Entry
E4M01_02280       CDS       T06201                                 

Definition
(GenBank) protocatechuate 3,4-dioxygenase
  KO
K15061  OH-DDVA oxygenase
Organism
brf  Brevundimonas sp. MF30-B
Pathway
brf00627  Aminobenzoate degradation
brf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:brf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    E4M01_02280
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: QBX36679
Position
460170..461198
AA seq 342 aa
MAEIVLGLWTTHGPTLSTTPEEWLLRLPADRARSNHPFRGKTYDFDSLVELRRDENLGEK
ASEAERTRRHAACRAAVERMADIYEAAKPDVAVIFGNDQGELFLDDIMPALTVFDGPTLW
NAPATEEQAAKMAPGIHAAEWGHNPPVRTDYPGEPELAAHIIRQAVADQFDVARSARLPE
NPGHWNSGIGHAFGFVYRQIMRDKVVPNVPLIANTFFPPNQPTARRMFEFGRSVGRAIRD
WDTDARVVVIGSGGMSHFVIDESFDRSIIDAIEARDGEMLCNIAESWFQSGTSELKNWVA
AAGCLFETDLSGDLVDYVPCYRSEAGTGTANGFVAWAERGQA
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggccgagatcgtcctgggcctctggacaacccacggccccaccctttcaaccacgcct
gaagagtggcttctgcgcctgccggccgatcgcgcgcgctccaaccatccattccgcggc
aagacctacgatttcgacagcctggtcgagctgcgtcgggatgagaacctgggggagaag
gcctcggaggccgagcgcacgcgtcgccacgccgcctgccgtgccgcggtggagcggatg
gccgacatctatgaggcggccaagcccgacgtcgcggtgatcttcggcaatgaccagggc
gaactgttcctcgacgacatcatgccggccctgaccgtcttcgacggccccaccctgtgg
aatgcacccgccacggaagagcaggcggccaagatggcgccgggaatccacgctgccgaa
tggggtcacaacccgccggtacgcacggactaccccggcgagcccgagctcgccgcgcac
atcatccgccaggccgtggcggatcagttcgacgtcgcccgctctgctcgcctgccggag
aacccggggcactggaacagcggcatcgggcatgccttcggcttcgtctatcgacagatc
atgcgcgacaaggtggtcccgaacgttcccctgatcgccaacaccttcttcccgccgaac
cagcccaccgcgcgccggatgttcgagttcggccgatcggtcggccgagcgatacgcgat
tgggacaccgatgcgcgcgtcgtggtgatcgggtctggcgggatgagccatttcgtcatt
gatgaatcctttgatcgcagcatcatcgacgcgatcgaggcccgcgacggcgagatgctg
tgcaatatcgcggagtcgtggttccagtcaggcacctcggagctcaagaactgggtcgcg
gccgccggctgtctgttcgagacggacctgtccggcgatctggtggactatgtgccctgc
tatcggtccgaagccggaaccggcacagccaacggattcgtcgcctgggccgagagagga
caggcatga

DBGET integrated database retrieval system