KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_00420Help
Entry
A4249_00420       CDS       T04395                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Pathway
brg00010  Glycolysis / Gluconeogenesis
brg00071  Fatty acid degradation
brg00350  Tyrosine metabolism
brg00625  Chloroalkane and chloroalkene degradation
brg00626  Naphthalene degradation
brg00680  Methane metabolism
brg01100  Metabolic pathways
brg01110  Biosynthesis of secondary metabolites
brg01120  Microbial metabolism in diverse environments
brg01200  Carbon metabolism
brg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:brg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A4249_00420
  09102 Energy metabolism
   00680 Methane metabolism
    A4249_00420
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A4249_00420
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    A4249_00420
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A4249_00420
   00626 Naphthalene degradation
    A4249_00420
Enzymes [BR:brg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A4249_00420
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     A4249_00420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ANC52281
UniProt: A0A168MXM8
Position
71151..72257
Genome map
AA seq 368 aa AA seqDB search
MKTRAAVAFEAKRPLEIVEVDLEGPRAGEVLIEIKATGICHTDAYTLDGLDSEGVFPSIL
GHEGAGVVVEVGPGVTSVAVGDHVIPLYTPECRQCKSCLSRKTNLCTAIRGTQGKGVMPD
GTSRFSYKGQAIAHYMGCSTFSNFTVLPEIAVAKIRKDAPFDKACYVGCGVTTGVGAVVN
TAKVEPGANCVVFGLGGIGLNVIQGLKMVGADMIVGVDINGDKEEWGRRFGMTHFVNPKD
VPDVVTHLVQLTDGGADYTFDCTGNTVVMRQALEACHRGWGESVVIGVAESGKEIATRPF
QLVTGRVWRGSAFGGARGRTDTPKIVDWYMDGKIEIDPMITNTFALDDINKAFDLMHEGK
SIRSVVVF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgcgccgccgtcgccttcgaggccaaacgtccgttggagatcgtcgaggtc
gatctggaggggccccgcgcgggcgaggtgctgatcgagatcaaggccaccggcatctgc
cacaccgacgcctatacgctggacgggctggactccgagggcgtcttcccctcgatccta
ggccacgagggcgcgggcgtggtggtcgaggtggggccgggcgtgacctcggtcgcggtc
ggcgatcacgtcatcccgctgtacacgccggaatgccgccagtgtaagtcgtgcctgtcg
cgcaagaccaacctgtgcaccgccattcgcggcacccagggcaagggcgtcatgcccgac
ggcaccagccgcttcagctacaagggtcaggccatcgcccactatatgggctgctcgacc
ttctcgaacttcaccgtcctgcccgagatcgcggtggccaagatccgcaaggacgcgccc
ttcgataaggcctgttacgtcggctgcggcgtgaccaccggcgtgggcgccgtggtcaac
acggccaaggtcgagcccggcgcaaactgcgtcgtcttcggcctgggcggcatcggcctg
aacgtcatccaggggctgaagatggtcggggccgacatgatcgtgggcgtggacatcaac
ggcgacaaggaagaatggggccgtcgcttcggcatgacccatttcgtcaatccgaaggat
gtgccggacgtggtgacccatctggtccagctgaccgacggcggcgcggactacaccttc
gactgcaccggcaacaccgttgtcatgcgccaggcgctggaggcctgccaccgcggctgg
ggcgagagcgtcgtcatcggcgtcgccgaatccggcaaggagatcgccacccgcccgttc
cagctggtgaccggccgcgtctggcgcggttcggccttcggcggcgcgcgcggccgcacc
gacacgcccaagatcgtcgactggtacatggacggcaagatcgagatcgaccccatgatc
accaacaccttcgccctggacgacatcaacaaggccttcgacctgatgcacgagggcaag
agcatccgctcggtcgtggtgttctga

DBGET integrated database retrieval system