KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_06175Help
Entry
A4249_06175       CDS       T04395                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Pathway
brg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
brg01100  Metabolic pathways
brg01110  Biosynthesis of secondary metabolites
brg01130  Biosynthesis of antibiotics
brg01230  Biosynthesis of amino acids
Module
brg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:brg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A4249_06175
Enzymes [BR:brg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     A4249_06175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N Phage_TAC_11
Motif
Other DBs
NCBI-ProteinID: ANC53279
UniProt: A0A160HWH7
Position
1255345..1256382
Genome map
AA seq 345 aa AA seqDB search
MGDGFKPILARLVEGHSLTSQQAHDFFAACLRGEPTPSQVAAAVTAMRMRGETVDEIAAF
AGAMREAALTLDHPYEVIDTCGTGGDGQHTYNISTAAALVLAGAGLKVAKHGNRAMSSKS
GSSDVLSILGVNLMASQAQQKKALDEAGICFLFAPAYHGAMRHVGPVRAEIGFRTVFNLL
GPLSNPASARRQVMGVYDPRLLEPLAEVLGRLGATRAWTVHGQGLDELATSGPTDVAEWK
DGAVRRFQVTPKDAGLPRASIADIRGGDAEENAVALRALLAGAAGPYRDIVLLNAAAALV
VSDRAADLADGAALAAGAIDDGRAAEALDRLARITSTPLESEEPA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacgggttcaagccgatcctcgcccgactggtcgagggccattccctgacgtcc
cagcaggcgcacgacttcttcgccgcctgcctgcggggcgagcccacgccttcccaggtc
gcagccgccgtcaccgccatgcggatgcgcggcgagaccgtggacgagatcgccgccttc
gcgggcgccatgcgtgaagccgctctgacgctggatcatccctatgaggtgatcgacacc
tgcggcaccgggggcgacggtcagcacacctacaatatctccaccgccgcagccctggtt
ctcgccggcgccggtctgaaggtcgccaagcacggcaatcgggcgatgtcttcgaaatca
ggctcttccgacgtcttgtcgatcctgggcgtgaacctgatggcgtcgcaggcgcagcag
aaaaaggcgctggatgaggccggtatctgcttcctgttcgcgcccgcctatcacggggcg
atgcgtcatgtcgggccggtgcgagccgagatcggttttcgcaccgtcttcaacctgttg
ggaccgctttcgaacccggcgtctgcaagacgacaggtcatgggcgtctatgatccgcgc
ctgctggagccgctggccgaggtgctgggccggcttggcgccacccgggcctggaccgtt
cacggccaaggcctggacgaactggcgacttccggccccacggacgtcgccgaatggaag
gatggcgcggttcgtcgcttccaggtcacgcccaaggacgccggcctgccgcgggcctct
atcgcagacattcgcggcggcgacgccgaagagaacgccgtcgccctgcgcgcgcttctg
gccggcgcggccggaccctaccgcgacatcgtgctgctgaacgccgccgccgccctcgtg
gtgtccgatcgcgcggccgatctggccgacggcgccgcgctcgcggctggcgccatcgac
gacggtcgagccgccgaggcgctggatcgcctggcccgcatcacctccacgccgctggaa
agcgaagagcccgcatga

DBGET integrated database retrieval system