KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_10055Help
Entry
A4249_10055       CDS       T04395                                 

Definition
(GenBank) fructose-1,6-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Pathway
brg00010  Glycolysis / Gluconeogenesis
brg00030  Pentose phosphate pathway
brg00051  Fructose and mannose metabolism
brg00680  Methane metabolism
brg01100  Metabolic pathways
brg01110  Biosynthesis of secondary metabolites
brg01120  Microbial metabolism in diverse environments
brg01130  Biosynthesis of antibiotics
brg01200  Carbon metabolism
brg01230  Biosynthesis of amino acids
Module
brg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:brg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A4249_10055
   00030 Pentose phosphate pathway
    A4249_10055
   00051 Fructose and mannose metabolism
    A4249_10055
  09102 Energy metabolism
   00680 Methane metabolism
    A4249_10055
Enzymes [BR:brg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     A4249_10055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ANC53967
UniProt: A0A160HY83
Position
2018205..2019290
Genome map
AA seq 361 aa AA seqDB search
MARITLRQLLDHAAENDYGLPAYNINNMEQGLAIMEAAHEVNAPVIIQASRGARNYANDI
VLAKLIDALAELYPHIPVCMHQDHGNGPATCATAIQYGFTSVMMDGSLEEDAKTPASYEY
NVDVTRRVTEMAHACGVSVEGELGVLGSLETGMGEAEDGHGFEGKLDHSQLLTDPDQAVD
FVAATKVDALAIAMGTSHGAYKFTRQPDGEVLAMNVIEEIHRRLPNTHLVMHGSSSVPQD
LQDIINQYGGEMPQTWGVPVEEIQRGIKHGVRKVNIDTDNRMAITGAIRKALMEKPGEFD
PRYYLKPAKEAMKKLCMERYQQFGCEGQASKIRPLSTAQMAKRYASGDLDPSFRGASVKA
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcatcacgctgcgacagctgctcgaccacgcggcagagaacgattacggcctg
cccgcctacaacatcaacaatatggaacagggtctggcgatcatggaggcggctcacgag
gtcaacgcccccgtcatcatacaggcctcgcgcggcgcccggaactacgccaacgacatc
gttctagccaagctgatcgacgccctggccgagctctatccgcacatcccggtctgtatg
caccaggatcacggcaacggcccggcgacctgcgccaccgccatccaatacggcttcacc
agcgtgatgatggacggttcgctggaggaggacgccaagacgcccgcctcctacgaatac
aacgtcgacgtcacccgtcgcgtcaccgaaatggcccacgcctgcggcgtctcggtcgag
ggcgaactgggcgtgctgggttcgctggaaaccggcatgggcgaggctgaggacggccac
ggcttcgagggcaagctggaccattcgcaactgttgaccgacccggatcaggccgtcgac
ttcgtcgcggccaccaaggtcgacgccctcgccatcgccatgggcaccagccacggcgcc
tacaagttcacgcgccagccggacggtgaagtcctggccatgaacgtgatcgaggaaatc
caccgccgcctgcccaacacccacctggtgatgcacggctcgtcgtcggtgccgcaggat
ctgcaggacatcatcaatcagtacggcggcgaaatgccccagacctggggcgtgccggtc
gaggagatccagcgcggcatcaagcacggcgtgcgcaaggtcaacatcgacaccgacaac
cgcatggccatcaccggcgccatccgtaaggccctgatggagaagccgggcgagttcgac
ccgcgctactatctgaagcccgccaaggaggcgatgaagaagctctgcatggagcgctac
cagcagttcggctgcgagggtcaggcctccaagatccgcccgctttccaccgcccagatg
gcgaagcgctacgcctcgggcgacctcgatccgtccttccgcggcgcatccgtcaaggcc
gcctag

DBGET integrated database retrieval system