KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_11170Help
Entry
A4249_11170       CDS       T04395                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Pathway
brg00071  Fatty acid degradation
brg00072  Synthesis and degradation of ketone bodies
brg00280  Valine, leucine and isoleucine degradation
brg00310  Lysine degradation
brg00362  Benzoate degradation
brg00380  Tryptophan metabolism
brg00620  Pyruvate metabolism
brg00630  Glyoxylate and dicarboxylate metabolism
brg00640  Propanoate metabolism
brg00650  Butanoate metabolism
brg00900  Terpenoid backbone biosynthesis
brg01100  Metabolic pathways
brg01110  Biosynthesis of secondary metabolites
brg01120  Microbial metabolism in diverse environments
brg01130  Biosynthesis of antibiotics
brg01200  Carbon metabolism
brg01212  Fatty acid metabolism
brg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:brg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A4249_11170
   00630 Glyoxylate and dicarboxylate metabolism
    A4249_11170
   00640 Propanoate metabolism
    A4249_11170
   00650 Butanoate metabolism
    A4249_11170
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A4249_11170
   00072 Synthesis and degradation of ketone bodies
    A4249_11170
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4249_11170
   00310 Lysine degradation
    A4249_11170
   00380 Tryptophan metabolism
    A4249_11170
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A4249_11170
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A4249_11170
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A4249_11170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:brg04147]
    A4249_11170
Enzymes [BR:brg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A4249_11170
Exosome [BR:brg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A4249_11170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANC54157
UniProt: A0A160HYN5
Position
2250151..2251353
Genome map
AA seq 400 aa AA seqDB search
MREAVIVSTARTPIGRAYRGAFNDTQAQQLGAHAVKHAVQRAGVDPAEIEDVIMGAALQQ
GSTGTNVARQIALAAGLPSSVPGMSLDRQCASGLMGIATAAKQVVFDQQKMAVGGGLESI
SLVQNQNMNLYRMKDEALLKLSPHIYMSMLETAEVVSRRYGVSRDRQDEYALKSQQRTAA
AQDAGRFDAEIVPMTTTMLVMDKATGQTSSKEITLSKDDGNRPDTTLEGLKALKPVFGGG
EEIQTGEFITAGNASQLSDGASACVVMEAGEAVKRNLQPLGAYRGMAVAGCEPDEMGIGP
VYAVPKLLKRHGLTMDDIGIWELNEAFAAQVLYCQDTLGIPDDRLNVSGGAISIGHPYGM
SGARMTGHVLIEGKRRGAKYGVVTMCIGGGMGAAGLFEIY
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaagccgtcatcgtctccaccgcccgcacccccatcgggcgcgcctatcgcggc
gccttcaacgacacccaggcgcagcagctcggcgcccatgcggtcaagcacgcggtccag
cgcgccggggtcgatccggccgagatcgaggacgtgatcatgggcgcggccctgcagcag
ggttcgaccggcaccaacgtcgcgcgccagatcgcgctcgccgccggcctgccctcttcc
gttccgggcatgagcctggatcgtcagtgcgcgtcgggcctgatgggcatcgccacggcg
gcgaaacaggtcgtcttcgatcagcagaagatggcggtcggcggcgggctcgaaagcatc
tccctggtccagaaccagaatatgaacctgtaccggatgaaggatgaggcgctgctgaag
ctgtcgccccacatctatatgtcgatgctggagacggccgaggtggtgtcgcgccgctac
ggcgtcagccgcgaccgccaggacgaatatgcgctgaaatcccagcagcgcacggccgcc
gctcaagacgccggtcggttcgacgccgagatcgtgcccatgaccaccacgatgctggtc
atggacaaggccaccggccagacctcatcgaaagagattaccctgtccaaggacgacggc
aaccgtcccgatacgacgctggaaggcctgaaggccttgaagcccgtgttcggcggcggc
gaggagatccagacgggcgagttcatcaccgccggaaacgcctcgcagctgtcggacggc
gcctcggcctgcgtcgtcatggaggccggtgaggcggtgaagcgcaatctgcaaccgctc
ggcgcctatcgcggcatggcggtcgctggctgcgagccggacgaaatgggcatcggcccg
gtctatgccgtgcccaaactgctgaagcgccacggcctgacgatggacgacatcggcatc
tgggaactcaacgaggccttcgcggcccaggttctgtattgccaagacacgctgggcatt
cccgacgaccgcctgaacgtctcgggcggcgccatctccatcggccacccctacggcatg
tccggcgcccgcatgaccggccatgtcctgattgaaggcaagcgtcgcggagccaaatac
ggcgtcgtcaccatgtgcatcggcggcggcatgggcgcggccgggctgttcgagatttac
tga

DBGET integrated database retrieval system